KEGG   Xenopus laevis (African clawed frog): 398234Help
Entry
398234            CDS       T01010                                 

Gene name
bub1, bub1a, xbub1
Definition
BUB1 mitotic checkpoint serine/threonine kinase
Orthology
K02178  
checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    398234 (bub1)
   04114 Oocyte meiosis
    398234 (bub1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398234 (bub1)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398234 (bub1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Other group
  BUB family
   398234 (bub1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1137 aa AA seqDB search
MDLQSQAQMFEAHIQGYKGDDPLDLWDRYVLWAEEALPPQEKQNIFCLLERLVRNFIGDK
RYCNDERYLKYCIRFADTINEPGQYFEYLYNQGIGHQSAALHVTWAQLLETQGDLQSASA
LYQKAIHSNAKPMEILDQHYRTFQIRNSQANIANRGAPVEPLGNSQILNQMNPTSASSNV
DQLSVAKCESSTPSENHPSQESACNVDRSGNKWVTISKSAVVPQPVKCVGVEVKQVPMYC
KDKLVCADSELSFEEFRASIYRKKYEQRRKMQQWEEEERKYKKFKEEAALQEQLLKQKME
QLSSLLHVQGRQEVLPQNTARQMPEVPQTTNSHFSISSGPITQNLPESETQASLVTDEPI
SVPTSLSAPAMPQMASSSMSSFGRKGCSPAAAEEWMPAPVDQSSVLSVAAPHVPRARVSE
QSILNKSQSNLDRSTATVLEMSKQVCQDTSSIVQGLRVQPGKKEVSAVGNSSGYLANTSH
VTPNTSLGLVQATPSKVLPSPTVNTKEALGFIMDIFQTSTLPDNVEEEEEETQDEIDQEF
EAFCRNDNKTGPNTVGFPVLPNVAPALPLDFCIFEDNVGKVNDLQSKPVEVKSLRERPAL
RPPLKSNEEVKAAESSVDDSTVWAVRCNKTLASSPNSTGDFALAARLASTPANKQTQPTW
QTLEDKENAVADSVVHTVFDFAEDKVIQVSKSRKLSPIQEQSPEHSKISGAVQSPSCTVI
PAESPAAELISDYVEQTGQKLAACKLSDTLYQPALGSLEDPWGVTTQTLDPYEEEKTETI
VNAPPELVIIENAWDEKLIDRLLSELPKSLGSHENYYPCHTMVPVLKPKMEVKLGSNSFY
IDNLLGEGAFAHVYQASLLDTNIQSNQKFILKVQKPAKPWEFYIGTQIRERINPELRHLF
IGFHAAHLFDNGSVLVGDLYNYGSLLNAINLYKKLSEKVMPAPLVMYFAINILYMVEQLH
NIGIIHGDVKPDNFAIGERFLENESCSLDFVSHGLALIDLGQSIDMTLFPKGTAFMGKCD
TSCFQCTEMLTKKPWNYQTDYFGVAGTVYCMMFGNYMKVKNEQGVWKPDGSFKRYQHGEL
WTEFFHTLLNVPDCHSPSPLRALREKLMSTFMLYTNKIKSFRNRLVILLLENKPSRK
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggatctacagagtcaggcacagatgttcgaagcccatattcagggatacaaaggcgac
gatccacttgatctctgggataggtatgtactttgggcagaagaagctctccccccacaa
gagaagcagaacattttttgtctgcttgagcgtctagttcggaacttcataggagacaaa
agatactgcaacgatgagcgatatctgaagtactgcatcagatttgctgacacaatcaat
gagccaggacagtattttgaatacctatataaccaaggcattggacatcagtctgctgct
ctgcatgtgacatgggctcagttgctagaaacacaaggagatctgcagagtgccagtgct
ctgtatcagaaggcaattcacagcaatgcaaagcctatggaaattctggatcagcactac
agaacattccagatcaggaactctcaagcaaatatagcaaatcgtggtgcaccagtggaa
ccccttgggaattctcagattttaaatcaaatgaacccaacttcagcatcatcaaatgtg
gatcagttatctgttgctaaatgtgagagctctacaccttcagaaaatcacccttctcaa
gaatctgcatgcaatgttgatagaagtgggaacaaatgggtcaccatctccaaatcagca
gtggttcctcagcctgtgaaatgtgtgggagtggaagtgaaacaggtccctatgtactgt
aaagataagctggtctgtgcagattctgagttgtcgtttgaggaattccgagcgagtatc
tacagaaagaaatatgagcagcgcagaaagatgcagcagtgggaggaagaagaaaggaaa
tacaagaaatttaaggaggaagcggctctccaggaacaactgttaaagcagaagatggag
cagctgagcagtctgctgcatgtccagggaaggcaggaggtgctgccccaaaatactgct
aggcaaatgcctgaggtcccccagactacaaatagccatttttctatatcaagtgggcca
ataactcaaaatcttccagaatcggaaacacaagcttcccttgttactgatgaaccaata
tctgtacctacctctctatctgctcctgctatgccacaaatggcttcctccagcatgtct
tcttttgggagaaaggggtgcagcccagctgctgctgaagagtggatgccagctccagtg
gatcagagctctgttctctctgtagcagcaccacatgttccaagggctcgtgtgtctgaa
caaagtatcctaaacaaatcccaatcaaatcttgacagatcgacggccactgttcttgaa
atgtccaaacaagtctgccaagacaccagttcaatagtacaaggtctcagagtccagcct
gggaaaaaggaagtatctgcagtcggaaactcgtctgggtatttagcaaatacatcacat
gtaacaccgaacacttctttgggcttggtgcaggcaactccatccaaagtattgccttca
cccactgtcaatactaaagaagcacttgggtttataatggacatcttccaaacatccaca
ctcccagataatgtggaagaagaagaggaggaaacccaagatgaaattgaccaggagttt
gaagccttttgtcgaaatgacaacaaaacgggtcctaacactgttggcttcccggtactg
cccaatgtcgcccctgcattgccattagacttctgtatcttcgaagacaacgtgggcaaa
gtgaacgacttacagagcaaaccagtagaagtaaaatcactccgcgaacgccctgcactg
agaccacctttgaaatctaatgaggaggtcaaagcagcagagtcttcggtagatgacagt
acagtgtgggcagttcgatgcaacaaaacgctagcctccagtccaaacagcacaggggac
tttgctctggcagcccgacttgcatctactcctgcaaacaagcagacacagccaacatgg
cagaccctggaagataaagagaatgcagttgctgacagtgtcgtccatactgtctttgac
tttgctgaggataaagtaatccaagtctccaaatcccgtaagctaagtccaatacaagaa
caaagcccagagcattccaaaatctcgggtgcagtgcagtctccttcatgcactgttata
cctgctgaatctccggcagctgagcttatatctgattatgtggagcagaccggccagaaa
ctggcagcatgcaaactatcagatacattgtaccaacccgcactgggaagcttggaagat
ccctggggggtaaccacacaaactctggatccatatgaagaggaaaaaacagaaaccatt
gttaatgctccacctgaactggttattattgaaaatgcatgggatgaaaaactaatcgac
cgtctcctgtctgaactaccaaaatcacttggttcccatgaaaactactatccgtgtcac
acaatggttcctgttttgaaacccaagatggaagtgaagctgggatccaattcattttat
attgataatctgctcggggaaggagcatttgcgcatgtctatcaggcctccttgttggat
acaaatatccagagtaatcagaagtttatattaaaggttcaaaagccagccaagccctgg
gagttctacattggaacacagataagagagaggataaatccagaattaaggcatctgttt
ataggcttccatgctgcacatctgtttgacaatggaagcgtgctggttggtgatctgtac
aactatggttcattgctgaatgccattaatctgtacaagaaactgagtgagaaagtaatg
ccagcaccactagtcatgtattttgccatcaacatcctctacatggtggaacagctccat
aacattgggattatccatggagacgtcaagcctgataactttgcgattggtgaaaggttc
ctggagaatgaatcgtgcagccttgattttgtatctcatggtctggcattgattgatctg
ggtcagagcatagacatgactctctttcctaaaggaactgctttcatgggaaagtgcgat
acgtcttgctttcagtgcactgaaatgctgactaaaaagccatggaactatcagactgac
tattttggagtggccgggacagtttactgtatgatgtttggcaattatatgaaagtgaag
aacgagcaaggagtctggaaaccagatggatcttttaaaagataccaacacggggagctt
tggacggagttttttcacaccttactgaatgtccctgactgtcacagtccatccccactc
cgggcccttcgggagaagctcatgtcaacattcatgctgtacaccaacaagatcaagtca
ttccgcaacagacttgtcatcctgcttctagagaacaagccttcccgcaaatag

DBGET integrated database retrieval system