KEGG   Xenopus laevis (African clawed frog): 398242Help
Entry
398242            CDS       T01010                                 

Gene name
bard1
Definition
(RefSeq) BRCA1 associated RING domain 1
  KO
K10683  
BRCA1-associated RING domain protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     398242 (bard1)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    398242 (bard1)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     398242 (bard1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 772 aa AA seqDB search
MLLRVRSGNRPSETAVREELPMMDEPGWERTRDALREMERKLCCSKCMFILKDPVCLGGC
EHVFCWTCVNENLGNECPLCNTPAWVRDVQVNRQLDNMIQLCAKLRNLLSMGKTDENKMD
LCQDTLLRLNPAQEKQKKKQIKMWFSPRSRKVRCVVEKKEKSQQISSKTLPQMASYEFVS
DSPDGEPAQKKPDPKPRKRMKKKLKDINAEWGVDTENEIDEVSNPRKEHKSGKSVSFCSS
AVIQHSPEVLVVESSLKNDTPEEISPNWNKCGLDEPMEMQSTSMKEVNCPSPSEQSTTLK
TQDKEKKITTVKRKKHSSPIASSKRPRRRSSDTSKPLNDSDIKANSPEKACKTVSPHKPS
ENSAKDVRIESTQAAKRDTKMCSTPLPCAKQNNSAKLGQKSTAMPISPNNLTNVKRNYKG
ETMLHLASIKGDIQGVEDLLNSGANPNVKDNAGWTPLHEACNLGHTMVVQLLLQHHALMN
TTGYQNDTPLHDAVKNGHIAIVKLLLSHGASRDAVNIFGLQPVDYAETEEMKSVLLETQT
ERDRLLLHPCLAAPQLSSHQRKEEAVVLIASGLLATQRADLTKLAKMLKASICAEYDSTV
THVIVSDEPVLRTMKCMMGILAGCWTLQFSWVKACLQSCNREPEESYEIPHGPHRARLNG
QQMLPQLLDGCHFYFLGCFTEHRKEDLIELVKAAGGQILIRQPKPDSDVTQTINTVAYHA
EADSDQRFCTQYIVFDRASKYRPERVRQGKVWFAPSSWIIECITSFQLLPVH
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaagggtgcgctccgggaaccggccttctgaaacggcagttagggaagaacta
cctatgatggatgagccgggctgggagcggacacgggacgcgcttcgggaaatggagaga
aagttgtgctgctccaaatgcatgtttatactgaaggatcctgtgtgtttgggtggatgc
gaacatgtattttgttggacatgtgttaatgaaaaccttggcaatgaatgcccactgtgt
aacacacctgcgtgggtgcgtgatgtacaagtaaaccgacaactagacaacatgatacag
ctgtgtgctaaactgcgaaacttgttgagcatgggaaaaacagacgaaaacaaaatggat
ttatgtcaggatacattgctcagactaaatcctgctcaagaaaaacagaagaaaaaacaa
ataaagatgtggtttagcccccgatccaggaaggtgagatgtgtagtggaaaaaaaagag
aagagccaacaaatttcatcaaaaactcttccacaaatggcatcgtacgagtttgtttcg
gattctcctgatggtgagcctgcgcaaaagaaacctgatccgaaacctaggaaaaggatg
aaaaaaaagttgaaagatattaatgcagaatggggtgttgatacagagaatgaaatagat
gaggtatctaatccaagaaaagaacacaagtcgggtaaatctgtttcgttttgtagctct
gccgtcattcaacatagtccggaggtgctggtggtagaaagcagcttgaagaatgacaca
ccagaagaaataagccctaattggaacaagtgtggcctggatgaacctatggaaatgcaa
tcaaccagtatgaaagaagtgaactgccccagtccaagtgaacaaagcaccacgttgaaa
acccaagacaaagagaaaaaaataactaccgtgaaacggaaaaaacactcatcccctata
gcttcttcaaagcggccaaggagaaggtctagtgatacctcaaagcctttgaatgacagc
gacataaaggcaaactcacctgaaaaagcctgtaaaacagtgtctccacataaaccttct
gaaaattctgcaaaagatgttcgaatagaaagcacgcaggccgcaaaacgggatactaaa
atgtgctccacgcctttaccctgtgcaaaacagaacaatagtgccaaattggggcaaaaa
agtacagcaatgccgatatcgccaaataatttgacaaatgtcaaaagaaattacaaagga
gagaccatgttgcatttagcatcaattaagggtgatattcaaggagtggaggaccttctt
aatagtggggcaaatcctaatgtgaaggacaatgctggctggactcctctgcatgaagct
tgcaatcttggacacacaatggttgttcagttgctccttcagcaccatgccctaatgaac
actacaggttaccagaatgatacaccacttcatgatgctgtgaaaaatggccacatagcc
attgtcaagctacttctgtctcatggagcttcccgggatgcagttaatatattcggtctg
cagcctgtagactatgcagaaacagaggagatgaagtcggtattgctggaaacccagaca
gagagagatcgacttttgttgcatccatgccttgcagctccacagctgagctcacaccag
cggaaagaagaagcggttgtgctaatagccagtgggctgctggccactcagcgtgccgat
ctgaccaagcttgcgaaaatgctgaaagctagtatttgtgctgaatatgacagcacagtt
acacatgtgattgtgagcgatgagcctgtgcttcgaaccatgaaatgcatgatgggtata
ttagctggatgctggacgcttcaattttcttgggtaaaagcctgcttgcaatcatgtaat
cgagaaccagaagagtcatatgagattcctcatggaccacacagagcacgactaaacgga
caacagatgctgccccagctgttggatggatgccatttctactttcttggctgttttaca
gagcatcgcaaagaagacctcattgaacttgttaaagctgctggtgggcaaatccttatt
cgtcagcctaaacctgatagtgatgtaacacaaaccattaacacggtggcataccatgca
gaagcagattctgatcaacggttctgcacacaatatattgtgtttgacagagcttccaag
taccgtcctgagagagtgcgccaggggaaagtttggtttgccccttccagttggataatt
gaatgcatcaccagctttcaactgttacctgtgcactag

DBGET integrated database retrieval system