KEGG   Xenopus laevis (African clawed frog): 398242Help
Entry
398242            CDS       T01010                                 

Gene name
bard1
Definition
BRCA1 associated RING domain 1
Orthology
K10683  
BRCA1-associated RING domain protein 1 [EC:6.3.2.19]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     398242 (bard1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 772 aa AA seqDB search
MLLRVRSGNRPSETAVREELPMMDEPGWERTRDALREMERKLCCSKCMFILKDPVCLGGC
EHVFCWTCVNENLGNECPLCNTPAWVRDVQVNRQLDNMIQLCAKLRNLLSMGKTDENKMD
LCQDTLLRLNPAQEKQKKKQIKMWFSPRSRKVRCVVEKKEKSQQISSKTLPQMASYEFVS
DSPDGEPAQKKPDPKPRKRMKKKLKDINAEWGVDTENEIDEVSNPRKEHKSGKSVSFCSS
AVIQHSPEVLVVESSLKNDTPEEISPNWNKCGLDEPMEMQSTSMKEVNCPSPSEQSTTLK
TQDKEKKITTVKRKKHSSPIASSKRPRRRSSDTSKPLNDSDIKANSPEKACKTVSPHKPS
ENSAKDVRIESTQAAKRDTKMCSTPLPCAKQNNSAKLGQKSTAMPISPNNLTNVKRNYKG
ETMLHLASIKGDIQGVEDLLNSGANPNVKDNAGWTPLHEACNLGHTMVVQLLLQHHALMN
TTGYQNDTPLHDAVKNGHIAIVKLLLSHGASRDAVNIFGLQPVDYAETEEMKSVLLETQT
ERDRLLLHPCLAAPQLSSHQRKEEAVVLIASGLLATQRADLTKLAKMLKASICAEYDSTV
THVIVSDEPVLRTMKCMMGILAGCWTLQFSWVKACLQSCNREPEESYEIPHGPHRARLNG
QQMLPQLLDGCHFYFLGCFTEHRKEDLIELVKAAGGQILIRQPKPDSDVTQTINTVAYHA
EADSDQRFCTQYIVFDRASKYRPERVRQGKVWFAPSSWIIECITSFQLLPVH
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaagggtgcgctccgggaaccggccttctgaaacggcagttagggaagaacta
cctatgatggatgagccgggctgggagcggacacgggacgcgcttcgggaaatggagaga
aagttgtgctgctccaaatgcatgtttatactgaaggatcctgtgtgtttgggtggatgc
gaacatgtattttgttggacatgtgttaatgaaaaccttggcaatgaatgcccactgtgt
aacacacctgcgtgggtgcgtgatgtacaagtaaaccgacaactagacaacatgatacag
ctgtgtgctaaactgcgaaacttgttgagcatgggaaaaacagacgaaaacaaaatggat
ttatgtcaggatacattgctcagactaaatcctgctcaagaaaaacagaagaaaaaacaa
ataaagatgtggtttagcccccgatccaggaaggtgagatgtgtagtggaaaaaaaagag
aagagccaacaaatttcatcaaaaactcttccacaaatggcatcgtacgagtttgtttcg
gattctcctgatggtgagcctgcgcaaaagaaacctgatccgaaacctaggaaaaggatg
aaaaaaaagttgaaagatattaatgcagaatggggtgttgatacagagaatgaaatagat
gaggtatctaatccaagaaaagaacacaagtcgggtaaatctgtttcgttttgtagctct
gccgtcattcaacatagtccggaggtgctggtggtagaaagcagcttgaagaatgacaca
ccagaagaaataagccctaattggaacaagtgtggcctggatgaacctatggaaatgcaa
tcaaccagtatgaaagaagtgaactgccccagtccaagtgaacaaagcaccacgttgaaa
acccaagacaaagagaaaaaaataactaccgtgaaacggaaaaaacactcatcccctata
gcttcttcaaagcggccaaggagaaggtctagtgatacctcaaagcctttgaatgacagc
gacataaaggcaaactcacctgaaaaagcctgtaaaacagtgtctccacataaaccttct
gaaaattctgcaaaagatgttcgaatagaaagcacgcaggccgcaaaacgggatactaaa
atgtgctccacgcctttaccctgtgcaaaacagaacaatagtgccaaattggggcaaaaa
agtacagcaatgccgatatcgccaaataatttgacaaatgtcaaaagaaattacaaagga
gagaccatgttgcatttagcatcaattaagggtgatattcaaggagtggaggaccttctt
aatagtggggcaaatcctaatgtgaaggacaatgctggctggactcctctgcatgaagct
tgcaatcttggacacacaatggttgttcagttgctccttcagcaccatgccctaatgaac
actacaggttaccagaatgatacaccacttcatgatgctgtgaaaaatggccacatagcc
attgtcaagctacttctgtctcatggagcttcccgggatgcagttaatatattcggtctg
cagcctgtagactatgcagaaacagaggagatgaagtcggtattgctggaaacccagaca
gagagagatcgacttttgttgcatccatgccttgcagctccacagctgagctcacaccag
cggaaagaagaagcggttgtgctaatagccagtgggctgctggccactcagcgtgccgat
ctgaccaagcttgcgaaaatgctgaaagctagtatttgtgctgaatatgacagcacagtt
acacatgtgattgtgagcgatgagcctgtgcttcgaaccatgaaatgcatgatgggtata
ttagctggatgctggacgcttcaattttcttgggtaaaagcctgcttgcaatcatgtaat
cgagaaccagaagagtcatatgagattcctcatggaccacacagagcacgactaaacgga
caacagatgctgccccagctgttggatggatgccatttctactttcttggctgttttaca
gagcatcgcaaagaagacctcattgaacttgttaaagctgctggtgggcaaatccttatt
cgtcagcctaaacctgatagtgatgtaacacaaaccattaacacggtggcataccatgca
gaagcagattctgatcaacggttctgcacacaatatattgtgtttgacagagcttccaag
taccgtcctgagagagtgcgccaggggaaagtttggtttgccccttccagttggataatt
gaatgcatcaccagctttcaactgttacctgtgcactag

DBGET integrated database retrieval system