KEGG   Xenopus laevis (African clawed frog): 398251Help
Entry
398251            CDS       T01010                                 

Gene name
bcl2l1, bcl-XL, bcl-x(l), bclxl, xR11
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Apoptosis
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:xla04630]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 204 aa AA seqDB search
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQ
ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR
ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE
RFGRLLTIVILTGVFALVCYMRRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggagggcagcagtagagatctggtggagaagtttgttagtaagaaactttcccagaat
gaagcctgcaggaagttctccaataatccccaacccaatgccatatctaatggaacttct
acttcagagcgccccggggaaggggccacgcagggcattgtggaggaggaagtccttcaa
gcccttttggaagcaacggaggagtttgagttgagatatcagcgtgccttcagtgacctg
acctcacagctgcacatcacccaggacacggcccagcagagcttccagcaagttatggga
gagttgttcagggatgggacaaactgggggagaattgtggctttcttctcatttgggcgg
gccctatgtgtggagagtgcaaacaaggagatgactgatctgctacccagaattgtccag
tggatggtgaattatctagagcacacactgcagccctggatgcaggagaatggaggctgg
gaagcttttgtcggcctgtatggaaagaatgccgcagcccagagcagagaaagccaggaa
cgatttggcaggttgctgactatagtgattctgactggtgttttcgcattggtctgctac
atgaggcgccgatag

DBGET integrated database retrieval system