KEGG   Xenopus laevis (African clawed frog): 398251Help
Entry
398251            CDS       T01010                                 

Gene name
bcl2l1.L, bcl-XL, bcl-x(l), bcl2l1, bclxl, xR11
Definition
(RefSeq) BCL2-like 1 L homeolog
  KO
K04570  
Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Mitophagy - animal
Autophagy - animal
Apoptosis
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    398251 (bcl2l1.L)
   04137 Mitophagy - animal
    398251 (bcl2l1.L)
  Cell growth and death
   04210 Apoptosis
    398251 (bcl2l1.L)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    398251 (bcl2l1.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     398251 (bcl2l1.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    398251 (bcl2l1.L)
Transporters [BR:xla02000]
 Other Transporters
  Pores ion channels [TC:1]
   398251 (bcl2l1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
9_10S
AA seq 204 aa AA seqDB search
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQ
ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR
ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE
RFGRLLTIVILTGVFALVCYMRRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggagggcagcagtagagatctggtggagaagtttgttagtaagaaactttcccagaat
gaagcctgcaggaagttctccaataatccccaacccaatgccatatctaatggaacttct
acttcagagcgccccggggaaggggccacgcagggcattgtggaggaggaagtccttcaa
gcccttttggaagcaacggaggagtttgagttgagatatcagcgtgccttcagtgacctg
acctcacagctgcacatcacccaggacacggcccagcagagcttccagcaagttatggga
gagttgttcagggatgggacaaactgggggagaattgtggctttcttctcatttgggcgg
gccctatgtgtggagagtgcaaacaaggagatgactgatctgctacccagaattgtccag
tggatggtgaattatctagagcacacactgcagccctggatgcaggagaatggaggctgg
gaagcttttgtcggcctgtatggaaagaatgccgcagcccagagcagagaaagccaggaa
cgatttggcaggttgctgactatagtgattctgactggtgttttcgcattggtctgctac
atgaggcgccgatag

DBGET integrated database retrieval system