KEGG   Xenopus laevis (African clawed frog): 398281Help
Entry
398281            CDS       T01010                                 

Gene name
spty2d1, P16H6
Definition
SPT2, Suppressor of Ty, domain containing 1
Orthology
K15193  
protein SPT2
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     398281 (spty2d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 800 aa AA seqDB search
MDFHSVLRMAAAKPGPDGVMKRYSLAVGPPRKDPKVKGVNSAAVQAFLRKKDQEIQNKEV
EAKRKKEGLLAKRKELKHDRKARAMASRTKDNFRGYNGIPVEEKPKKHKGSGLEEGPNES
MQSTEEDEEYMTEEELYEYSQSESEREEEQEEMPPQKVAKAAPGKKPPPPALNFTELLRL
AERKQHEPVEVIRPLKKEERLRTAEELKELEFLERKAQKADRKDPMRNGQVVKISKGSGD
KYYSLKGSHSVEKRSHENSKSSSTEQNGTFRKSSSDNRSREEKSGSVFHTKDSKFPTKSS
SAKDCGAKGFRPSATGDCKNRNDSTRASGSTSLRPSSGGSSSVSGRPSGSSEKPGSSSGK
PMGGSGSSSARSSSGSGKPTGATGSGKPTGASGSGSARSVGESGSRSGKPTGASGSGLAR
SVGASGSGSGKPTGATDSGRPTGVSGSGSARSVGASGSGKPTGASVSGSARSVGASGSGK
PTGASGSGSARSVGASRSVSGKPTGASGSGKPTGAPGASSGKPAGVSGSVSSFARPRSNS
SMAPAKPAASSGSARPSSSGTPRASSTGNSSSNYSRQASSSGAVRPSSGPPTGGTPKGPS
PRPGTGPNSVRHNTTSISVSARSSLGSGPGRPVAASATGQSAMAKPKCTVVAETISSKNF
VPKSINGHMNGMRSAVPPGHRPNMQPPGRPLPPITSSYKRRIDDDEYDSEMDDFIDDGGE
CQDEISKHIREIFGYDRNRYRDESDYALRYMESSFREQQKEEARSLRLGIQEDLEELRRE
EEELKQKAKQLKSAKKMKSR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggatttccacagtgtgctgagaatggctgccgccaaaccggggccggacggtgtaatg
aaaaggtacagtcttgctgtgggcccccctcgcaaggatccgaaggtgaaaggtgtgaat
tctgcagcagtgcaggccttcctcaggaagaaagatcaggagatacagaacaaagaggtt
gaggcaaagaggaagaaggaggggttgttggccaaacgcaaggagttgaaacatgataga
aaagcccgtgccatggcttccaggacaaaggacaacttcaggggttataatgggattcca
gttgaagagaagcccaaaaagcataaaggctccggcctggaagagggtccgaatgaaagc
atgcagtccactgaggaggatgaggagtatatgacagaggaggaattgtatgagtactct
cagtctgaatctgagcgggaggaggaacaggaggaaatgccccctcagaaagtggctaaa
gcagcacctggaaagaagcccccgcctccagcgctaaacttcacagaactgctacgtctc
gctgaacgaaagcaacatgaaccagtagaagtgatccgacctctgaagaaagaggaacgg
ctccgaaccgcagaagaactcaaagagttggaatttctagagaggaaagcccagaaggca
gatagaaaagatccaatgagaaatgggcaagttgtaaaaatcagtaaaggttctggagac
aaatattactcgctgaaaggaagtcattcggtagagaaaaggtcccatgaaaactcaaag
tccagctccactgagcagaatggtaccttcagaaagtcctccagtgataatagaagcaga
gaagagaagagtgggtccgtattccataccaaagattcaaagtttcccacaaagtcatct
tctgccaaggactgtggtgccaaaggttttagacccagtgcaacaggggattgcaagaat
agaaatgactctacccgagcctccggttccacttctctgcgtccttcttctggaggttca
agttctgtttcagggagaccatctggaagttctgaaaaaccaggttctagttcaggaaag
cctatgggaggatcaggttctagttcagcaaggtcaagttctggttcagggaagccaaca
ggagccacgggttcagggaagccaacaggagcatcaggttctggttcagcaaggtcagtg
ggagagtcgggatctcggtcagggaagccaacaggagcatcaggttctggtttagcaagg
tcagtgggagcatctggttctggttcagggaagccaacaggagcaacggattcagggagg
ccaacaggagtatcaggttctggttcagcaaggtcagtgggagcatcgggttcagggaag
ccaacaggagcatcagtttctggttcagcaaggtcagtgggagcatcgggttcagggaag
ccaacaggagcatcaggttctggttcagcaaggtcagtgggagcatcgcgttctgtttca
gggaagccaacaggagcatcaggttcagggaagccaacaggagcaccgggtgctagttca
gggaaaccagcaggagtatccggttctgtttctagttttgcccggccacggagcaattct
agtatggctcctgccaagcctgctgctagttctggttctgcccgaccctccagttcagga
acaccacgtgcaagcagtactggtaattcctccagcaattattcacgtcaggctagcagc
tcaggagcagtgcggcccagtagtggccctccaacaggtggtacacctaaaggcccctct
cctcggccaggaactggaccgaactctgtgcgtcataacacaacttcaatctcggtttct
gctcgttcctcccttggctcaggacctggtcggccggtggctgcttcagcaacaggacaa
tcggcaatggcaaaaccaaaatgtactgtggtggctgaaaccatatcttccaagaacttt
gtacccaagtccatcaatgggcatatgaatggaatgagatcagcagtgccccctgggcat
agacctaacatgcagccaccaggtcgccctttgcctcccatcaccagctcttacaaacga
agaattgacgacgatgaatatgattcagagatggatgattttatagatgacgggggtgaa
tgccaggatgaaatatccaagcacattcgggaaatatttggctatgacagaaataggtac
agggatgagagcgattatgccctgaggtacatggaaagcagctttcgagagcagcagaaa
gaagaggcaagaagcctgcgattgggcatccaggaagacttggaggagttgaggcgtgag
gaggaggagctaaagcagaaagccaagcagttaaagtcagcgaagaagatgaagagtcga
tag

DBGET integrated database retrieval system