KEGG   Xenopus laevis (African clawed frog): 398288Help
Entry
398288            CDS       T01010                                 

Definition
mu/m-calpain large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MIPFGGIASKLKIDRLKASGVGSHDCAVKYQNQDYESLKQQCVESGILFEDPNFPAIPSI
LGFKELGPGSSKTRGVQWKRPSDIVDDPQFIIGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVIDDLLPVKDGELVFVHSAECTEFW
SALLEKAYAKLNGSYESLSGGSTTEGFEDFTGGVAEMYELRKAPRDLDKIIKRALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTALKEVNYMGEMEKLIRIRNPWGQVEWTGAW
SDNSSEWNEVDPSEQEDLRLKMEDGEFWMSFQEFLRQFSRLEICNLTPDTLNKEGLSKWH
TTLYDGSWRRGSTAGGCRNNPATFWINPQFKVTLLEEDDDPDDNELACSFLVALMQKNRR
NERKAGQDMHTIGFAVYEVPDEFKGCQNVHLKKDFFLRHQSCARSETFINLREVSTKIHL
PPGEYIIVPSTFEPHKEADFIMRIFTEKHSDIQELDEEVTADLPEEEELTEDDVDDSFKA
MFQQLAGDDMEISVFELKTILNRVVAKHKDLKTDGFGMEACRQMVNLLDKDGSGKLGVVE
FQILWNKFEMAVMALLPACMGPVGINYTPSLQTVFREHDLDKSGTISSYELRIALESSGY
KLNNKLIQVLVARYADSDMGIDFDNFVCCLVKLEAMFKFFKALDEGDGTAEMNLGEWLTM
TMSG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgattccgttcgggggaatagcatctaaactcaagatcgaccgcctgaaggcatccggt
gtgggctcacatgattgcgccgtgaaataccagaaccaggattatgagagtcttaaacag
caatgtgtggagagtggcatcctcttcgaagatccaaatttcccagccatcccttctatc
ctgggcttcaaggaattgggccctggatccagcaaaactagaggcgtgcaatggaagcgg
ccgtcagacattgttgatgacccacagtttatcatcggcggagcaaccagaacagacata
tgccagggggcattgggggactgttggctccttgctgccattggctccctgacgctgaat
gaggatttgctgcacagagtggtaccgcatgggcagagcttccaggaggattacgctggg
atattccacttccagatctggcagtttggtgagtgggtcgatgtggtgatagatgacctt
ttgccggtaaaggatggggagctggtatttgtgcactcagctgagtgtacggagttctgg
agtgccctgctggaaaaggcctatgccaagttgaatggttcatatgagtccctttctggt
gggagcaccaccgagggctttgaggactttaccggaggagttgcagaaatgtacgaacta
cgcaaagcacctcgagacttagataagataataaaacgggcattggagagagggtccctt
ctcggatgttcaatagatataacaagtgcctttgacatggaagctgttacatttaagaag
cttgtgaagggacacgcatactctgtcaccgctctcaaagaggttaattacatgggagaa
atggaaaagcttattcgcatcaggaatccctgggggcaggtggaatggactggagcctgg
agtgataactcctcagagtggaatgaagtggacccttctgagcaggaggacctgcggcta
aagatggaggatggagagttctggatgtctttccaagaattcctgcgccagttttcacgt
ctggaaatctgtaacctgaccccggacacgctaaataaagaggggctgagcaagtggcac
accactctgtacgatggcagttggcgccggggaagcaccgccggtggctgcaggaacaac
ccagccacattctggatcaaccctcagttcaaagtcactctgctggaggaggatgatgac
cctgatgacaatgagttggcctgcagtttcctggtggccctgatgcagaagaaccgacgg
aatgagcggaaggcaggacaagacatgcacaccattggctttgctgtatatgaggttcct
gatgagtttaagggctgccagaatgttcatctgaagaaagatttcttcctgcgccaccaa
tcctgtgcccgctctgaaacctttatcaacctacgtgaagtcagcaccaagatccacctg
ccccctggggagtacatcattgttccctcgaccttcgaaccgcacaaggaggcagatttt
atcatgcgaatattcactgaaaaacattcagatatacaggagttggatgaggaggtgaca
gcagatcttcctgaagaggaggaactcacagaagacgatgtggatgattcattcaaggcc
atgtttcagcagctggcaggagatgacatggagatcagtgtgtttgagctgaagaccatc
ctgaacagagtggtggccaaacacaaagatctgaagacggatggttttggtatggaggcc
tgtaggcagatggtcaatctgttggacaaagatggaagcggcaagttgggagttgtggag
tttcagatcctgtggaacaaattcgaaatggctgtcatggccttgttacctgcatgcatg
ggccccgtgggaataaactacactccatctttacagactgtttttcgagaacacgactta
gacaagtccggcaccatcagctcttatgagctacgcattgccctggaaagttcagggtac
aaactgaataacaagctcattcaggttctggtcgctcgttacgctgattccgacatgggc
attgattttgataacttcgtgtgctgtctagtgaagctggaggccatgttcaagttcttc
aaggcattggacgaaggcgatggcacagctgagatgaatttgggggagtggctgacgatg
actatgagcggataa

DBGET integrated database retrieval system