KEGG   Xenopus laevis (African clawed frog): 398295Help
Entry
398295            CDS       T01010                                 

Gene name
nlk.2.S, nlk, nlk.2, xnlk
Definition
(RefSeq) nemo-like kinase, gene 2 S homeolog
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    398295 (nlk.2.S)
   04310 Wnt signaling pathway
    398295 (nlk.2.S)
   04068 FoxO signaling pathway
    398295 (nlk.2.S)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    398295 (nlk.2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     398295 (nlk.2.S)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   398295 (nlk.2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 447 aa AA seqDB search
MAFPGSGRSIPGQLCAGVFSGLIQPPLGQKFYCPNGGGAVPSPLPQALSAPQCNGEGRDP
EPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVL
SALDILQPPQIDCFEEIYVITELMQTDLHKVIVSPQPLSSDHIKVFLYQILRGLKYLHSA
GILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESQHMTQEVVTQYYRAPEILMGSRHY
RSAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLTAMRSACEGARAHILR
GPHKPPSLSVLYMLSGEATHEAVHLLCRMLLFDPLKRISAKDALAHPYLEEGRLRYHTCM
CHCCYSVSSGRVYTADFEPTATNRFDDSYEKSLTSVWQVKELVHRFITDQHQGKRPPLCI
NPHSAAFKTFIRSTAWHSSKVSKKEER
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccttcccgggctcgggccgttccattccggggcagctgtgcgcgggggtgttcagt
ggtctcatccagccccccctgggccaaaagttctactgtcccaatgggggaggggctgtt
ccttcgcctttaccccaagctctcagcgccccccagtgtaacggggaagggagagacccg
gagcccgacaggcccatcggatacggggcattcggagtggtctggtcggtgactgaccct
cgggatggcaaacgtgttgctctcaagaagatgccgaatgtcttccaaaacctggtgtcc
tgcaagagggtcttcagagaactcaagatgctctgcttcttcaaacacgacaatgttctg
tcggcactggatatcctgcagcccccccagatcgactgctttgaagagatatatgtgatc
acagagctcatgcagactgatctgcacaaggttatagtgtccccccagccgctcagctcc
gaccacatcaaggttttcctctatcagatcctacgcggcctgaagtatctgcactctgct
gggattctgcaccgagacattaaaccaggaaatctgcttgtcaacagcaactgtgttcta
aagatctgtgactttggcctggcccgagtggaggaactggatgagtcccagcacatgacc
caggaggtggtgactcagtattaccgggcccctgagatcctgatggggagccgacactac
cgcagtgccattgatatctggtctgtcggctgcatcttcgctgaactcctgggacgaaga
attctttttcaggcacagagccccattcaacagctggacctgatcacggatctcctgggc
accccccctctcaccgccatgcgctcggcctgtgagggagcaagagctcacattctgcgt
ggcccccacaagccgccgtccctctcagtcctgtacatgctctcgggagaagctacccat
gaggctgttcacctcctgtgccggatgctgctgtttgacccgctgaagcggatctctgcc
aaggatgccctggcccacccctatctagaagaaggtcgtctgcgctaccacacgtgtatg
tgtcactgctgctactccgtgtcctctgggcgggtctacactgcagacttcgagcccacg
gccaccaaccgatttgatgactcctacgagaaaagcctcacttctgtctggcaggtcaaa
gagctggttcatcgctttatcactgaccagcaccaggggaagcgccccccgctgtgtatt
aatccgcactctgcagccttcaaaaccttcatcagatcaacagcgtggcattcctcaaaa
gtttccaagaaggaagaaagatga

DBGET integrated database retrieval system