KEGG   Xenopus laevis (African clawed frog): 398295Help
Entry
398295            CDS       T01010                                 

Gene name
nlk.2, nlk, xnlk
Definition
nemo-like kinase, gene 2 (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:xla04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell communication; Adherens junction [PATH:xla04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 447 aa AA seqDB search
MAFPGSGRSIPGQLCAGVFSGLIQPPLGQKFYCPNGGGAVPSPLPQALSAPQCNGEGRDP
EPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVL
SALDILQPPQIDCFEEIYVITELMQTDLHKVIVSPQPLSSDHIKVFLYQILRGLKYLHSA
GILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESQHMTQEVVTQYYRAPEILMGSRHY
RSAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLTAMRSACEGARAHILR
GPHKPPSLSVLYMLSGEATHEAVHLLCRMLLFDPLKRISAKDALAHPYLEEGRLRYHTCM
CHCCYSVSSGRVYTADFEPTATNRFDDSYEKSLTSVWQVKELVHRFITDQHQGKRPPLCI
NPHSAAFKTFIRSTAWHSSKVSKKEER
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccttcccgggctcgggccgttccattccggggcagctgtgcgcgggggtgttcagt
ggtctcatccagccccccctgggccaaaagttctactgtcccaatgggggaggggctgtt
ccttcgcctttaccccaagctctcagcgccccccagtgtaacggggaagggagagacccg
gagcccgacaggcccatcggatacggggcattcggagtggtctggtcggtgactgaccct
cgggatggcaaacgtgttgctctcaagaagatgccgaatgtcttccaaaacctggtgtcc
tgcaagagggtcttcagagaactcaagatgctctgcttcttcaaacacgacaatgttctg
tcggcactggatatcctgcagcccccccagatcgactgctttgaagagatatatgtgatc
acagagctcatgcagactgatctgcacaaggttatagtgtccccccagccgctcagctcc
gaccacatcaaggttttcctctatcagatcctacgcggcctgaagtatctgcactctgct
gggattctgcaccgagacattaaaccaggaaatctgcttgtcaacagcaactgtgttcta
aagatctgtgactttggcctggcccgagtggaggaactggatgagtcccagcacatgacc
caggaggtggtgactcagtattaccgggcccctgagatcctgatggggagccgacactac
cgcagtgccattgatatctggtctgtcggctgcatcttcgctgaactcctgggacgaaga
attctttttcaggcacagagccccattcaacagctggacctgatcacggatctcctgggc
accccccctctcaccgccatgcgctcggcctgtgagggagcaagagctcacattctgcgt
ggcccccacaagccgccgtccctctcagtcctgtacatgctctcgggagaagctacccat
gaggctgttcacctcctgtgccggatgctgctgtttgacccgctgaagcggatctctgcc
aaggatgccctggcccacccctatctagaagaaggtcgtctgcgctaccacacgtgtatg
tgtcactgctgctactccgtgtcctctgggcgggtctacactgcagacttcgagcccacg
gccaccaaccgatttgatgactcctacgagaaaagcctcacttctgtctggcaggtcaaa
gagctggttcatcgctttatcactgaccagcaccaggggaagcgccccccgctgtgtatt
aatccgcactctgcagccttcaaaaccttcatcagatcaacagcgtggcattcctcaaaa
gtttccaagaaggaagaaagatga

DBGET integrated database retrieval system