KEGG   Xenopus laevis (African clawed frog): 398295Help
Entry
398295            CDS       T01010                                 

Gene name
nlk.2, nlk, xnlk
Definition
nemo-like kinase, gene 2 (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    398295 (nlk.2)
   04310 Wnt signaling pathway
    398295 (nlk.2)
   04068 FoxO signaling pathway
    398295 (nlk.2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    398295 (nlk.2)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     398295 (nlk.2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   398295 (nlk.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 447 aa AA seqDB search
MAFPGSGRSIPGQLCAGVFSGLIQPPLGQKFYCPNGGGAVPSPLPQALSAPQCNGEGRDP
EPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVL
SALDILQPPQIDCFEEIYVITELMQTDLHKVIVSPQPLSSDHIKVFLYQILRGLKYLHSA
GILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESQHMTQEVVTQYYRAPEILMGSRHY
RSAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLTAMRSACEGARAHILR
GPHKPPSLSVLYMLSGEATHEAVHLLCRMLLFDPLKRISAKDALAHPYLEEGRLRYHTCM
CHCCYSVSSGRVYTADFEPTATNRFDDSYEKSLTSVWQVKELVHRFITDQHQGKRPPLCI
NPHSAAFKTFIRSTAWHSSKVSKKEER
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccttcccgggctcgggccgttccattccggggcagctgtgcgcgggggtgttcagt
ggtctcatccagccccccctgggccaaaagttctactgtcccaatgggggaggggctgtt
ccttcgcctttaccccaagctctcagcgccccccagtgtaacggggaagggagagacccg
gagcccgacaggcccatcggatacggggcattcggagtggtctggtcggtgactgaccct
cgggatggcaaacgtgttgctctcaagaagatgccgaatgtcttccaaaacctggtgtcc
tgcaagagggtcttcagagaactcaagatgctctgcttcttcaaacacgacaatgttctg
tcggcactggatatcctgcagcccccccagatcgactgctttgaagagatatatgtgatc
acagagctcatgcagactgatctgcacaaggttatagtgtccccccagccgctcagctcc
gaccacatcaaggttttcctctatcagatcctacgcggcctgaagtatctgcactctgct
gggattctgcaccgagacattaaaccaggaaatctgcttgtcaacagcaactgtgttcta
aagatctgtgactttggcctggcccgagtggaggaactggatgagtcccagcacatgacc
caggaggtggtgactcagtattaccgggcccctgagatcctgatggggagccgacactac
cgcagtgccattgatatctggtctgtcggctgcatcttcgctgaactcctgggacgaaga
attctttttcaggcacagagccccattcaacagctggacctgatcacggatctcctgggc
accccccctctcaccgccatgcgctcggcctgtgagggagcaagagctcacattctgcgt
ggcccccacaagccgccgtccctctcagtcctgtacatgctctcgggagaagctacccat
gaggctgttcacctcctgtgccggatgctgctgtttgacccgctgaagcggatctctgcc
aaggatgccctggcccacccctatctagaagaaggtcgtctgcgctaccacacgtgtatg
tgtcactgctgctactccgtgtcctctgggcgggtctacactgcagacttcgagcccacg
gccaccaaccgatttgatgactcctacgagaaaagcctcacttctgtctggcaggtcaaa
gagctggttcatcgctttatcactgaccagcaccaggggaagcgccccccgctgtgtatt
aatccgcactctgcagccttcaaaaccttcatcagatcaacagcgtggcattcctcaaaa
gtttccaagaaggaagaaagatga

DBGET integrated database retrieval system