KEGG   Xenopus laevis (African clawed frog): 398314Help
Entry
398314            CDS       T01010                                 

Gene name
dlat.L, dlat, dlat.S
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase L homeolog
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    398314 (dlat.L)
   00020 Citrate cycle (TCA cycle)
    398314 (dlat.L)
   00620 Pyruvate metabolism
    398314 (dlat.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     398314 (dlat.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
7L
AA seq 628 aa AA seqDB search
MLRLCLRFRAPARSVLSGRSQATSAGRYRRLHVGPGNRLRGLVGSPANVPLLKGAWRQGT
ASGKRWYSLPPHQKVPLPALSPTMQMGTIARWEKKEGDKINEGDLIAEVETDKATVGFES
LEEGYMAKILVAEGTRDVPIGSVICITVDKAEFIDAFKNYTLDSAAAASPSVAAATPSPP
PQSAVQAPGSTYPNHMKICLPALSPTMTMGTVQKWEKKVGEKLSEGDLLAEIETDKATIG
FEVPEEGYLAKILVAEGTRDVPLGTPLCIIVEKESDISSFADYKESTGVVDIKPQHAPPT
PTAASVPVPPVAVSTPAPTPSAAPSAPKGRVFVSPLAKKLAAEKGIDIKQVKGSGPEGRI
TKKDIDSFVPPKAAPAPVAAPTPAVAVPSPAVAAVPSGVFTDVPISNIRRVIAQRLMQSK
QTIPHYYLSIDINMGEITQLRKELNEVTKADNIKLSFNDFIIKASALACLKVPEANSSWM
DTVIRQHHVVDVSVAVSTPVGLITPIVFNAHIKGLASISKDVLSLATRAREGKLKPHEFQ
GGTFTVSNLGMYGIKNFSAIINPPQACILAVGGSENRLIPADNEKGFDVASVMSVTLSCD
HRVVDGAVGAQWLAEFKKFLEKPTTMLL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcctgtgcctaaggttccgcgctccggctcggtctgttttatcgggccggagt
caagctacgtcagcgggtcggtaccgaaggcttcacgtgggacctgggaaccggctgaga
ggcttggtcgggtctccggcaaatgttccactgctaaagggagcttggagacagggaacg
gcctctggaaagagatggtacagcctacctccccaccagaaggtgcctttgcctgccttg
tctcccacaatgcagatgggaaccatagctcgctgggagaagaaagaaggtgataaaatt
aacgaaggggatctaatagctgaggttgaaactgacaaggccactgtcggtttcgaaagt
ctggaggagggttatatggctaaaatccttgtggcagaaggaacaagagatgtgcccatt
ggttcagttatttgtattactgtggacaaggcagaatttattgatgcttttaaaaattac
acattggactccgcagcagcagcttctccaagtgtggcagctgctaccccatcaccacct
cctcagtctgcagttcaagcccctggtagcacttaccccaaccatatgaaaatttgtctg
cctgcactttctccgaccatgaccatgggtacagtgcaaaagtgggagaagaaagttggt
gagaagctcagcgagggagaccttttggctgaaatagagacggacaaagctaccatagga
tttgaagtgccagaagaaggttatttggctaaaattcttgtcgcagaaggcacacgtgat
gtacccttgggcacacctctttgcattattgtggagaaagagtctgatattagcagcttt
gcagattacaaagagtcaactggagtagttgatattaaacctcagcatgcacctcccact
ccgactgcagcttcagtgcctgttcctccagtagcagtgtctacccctgctcctacaccc
agtgctgctccctcagctcccaaaggaagggtgtttgtaagtcctcttgccaaaaagcta
gctgctgaaaaaggaattgatataaagcaagtgaaaggaagtgggcctgaaggaagaatt
acaaagaaagatattgactcatttgttcctcccaaagctgctccagctccagttgcagcc
ccaacacctgcagttgctgtaccatctccagctgtggctgctgttcccagtggagtcttc
acagatgttcccattagtaatattcgcagggtcatcgctcagcgactcatgcagtccaag
caaaccataccacactactatttatccattgatataaacatgggggaaatcacacagttg
cgaaaagaactcaatgaggttaccaaggctgacaacattaaactgtcatttaatgacttc
attattaaagcatcagctctggcatgtttgaaggtcccagaagcaaactcctcctggatg
gacactgtaattcgacagcatcacgtggttgatgtaagtgtggcggtaagcaccccagtt
ggtctgataactcctattgtgttcaatgcccacatcaaggggctggcatccatcagcaaa
gatgtgctgtctctagcaacccgggcacgagaaggcaagcttaaacctcatgaatttcaa
ggtggaaccttcactgtatccaacttgggaatgtatggaatcaaaaacttctctgccata
ataaacccgccccaggcctgcatccttgctgtaggagggtcagaaaatagactgatacct
gcagacaatgaaaaaggctttgacgttgccagtgtgatgtctgttactttaagctgcgat
caccgtgttgtggacggggcagttggagcacagtggcttgctgaattcaaaaaattcttg
gagaaaccaacaacaatgctgctctaa

DBGET integrated database retrieval system