KEGG   Xenopus laevis (African clawed frog): 398318Help
Entry
398318            CDS       T01010                                 

Gene name
mp36, setd8-B
Definition
mitotic phosphoprotein 36 (EC:2.1.1.43)
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    398318 (mp36)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     398318 (mp36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 287 aa AA seqDB search
MSPTKSPSGRPPLQEENSVVHHESKNLGKPTTETRKKAEVEKKRISSATELSVKSSKQRE
TECNSIGEYFQTKQELTDVQRNTALTPVRQAAVSEDGYKQISKKEAQRKKSPNRKLTDYY
PVRRSCRKSKTELESEEKMRIDELIQTGKEDGMKMDMIIGKGRGVIATRDFQRGEFVVEY
HGDLIEITDAKRREASYAQDSATGCYMYYFQYLNKTYCIDATRETGRLGRLINHSKSGNC
HTKLHNISNVPHLILVASRDILVGEELLYDYGDRRKSSIEAHPWLKN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaactaaatctcccagtggccgccctcccctgcaggaagaaaactctgttgta
caccatgagagcaagaatctggggaaacccacaacagagactcgcaaaaaagcggaggtt
gagaaaaagagaatatcttcagcaacagaactgtcagtaaaatccagtaagcaaagagag
actgaatgcaattccataggagagtattttcaaacaaaacaagaactgaccgacgtacag
agaaacaccgcattgacacctgttagacaagctgcagtctcagaagatggttataaacaa
atctcaaagaaggaagctcaaagaaagaaatccccaaacagaaaacttactgattattac
cctgtgagaagaagctgcaggaagagcaaaacggagcttgagtcagaggagaagatgaga
atagatgaacttattcagactggcaaagaagatgggatgaagatggacatgattattggg
aaaggtcgaggcgtaattgccactcgggacttccagcgaggagagtttgttgtagaatac
catggagatctaatagaaatcacggacgctaaaaggagagaggcgtcctatgcacaggat
tcagctactggctgctatatgtactattttcagtatttgaacaaaacctactgcattgat
gccacaagagagactggccgtttaggaaggctgataaaccacagcaagtctgggaactgt
cacaccaaactgcacaacatcagcaatgtacctcaccttatactcgttgcatcgcgggat
atcctagttggagaggaattactgtatgactatggtgataggagaaaatcttccattgag
gcacatccttggcttaaaaactga

DBGET integrated database retrieval system