KEGG   Xenopus laevis (African clawed frog): 398349Help
Entry
398349            CDS       T01010                                 

Gene name
aurka-b, ARK-1
Definition
p46XlEg22 (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    398349 (aurka-b)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398349 (aurka-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398349 (aurka-b)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   398349 (aurka-b)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     398349 (aurka-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 408 aa AA seqDB search
MERAVKENHKPSNVKVFHPMTEGPKRIPVSQPPSTQVRPPVTGVSAQRILGPSNVPQRVM
MQAQKPVLSNQKPTAQGLLRPATHGHQTSKPQGPNENRNPQQTSHSSTPNMEKKGSTDQG
KTLAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAG
VEHQLRREVEIQSHLRHPNILRLYGYFHDACRVYLILDYAPGGELFRELQKCTRFDDQRS
ALYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTL
DYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVS
EEAKDLVSKLLKHNPNHRLPLKGVLEHPWIVKNSQQPKKKDEPLAGAQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggctgttaaagagaaccacaaaccttctaatgtcaaggtttttcacccaatg
acggagggtcccaaacgtatcccagttagccagcctccgagcacccaggttaggcctcct
gtgactggagtctctgctcagaggatattgggtccctctaatgtgccccagcgggtgatg
atgcaggctcagaaacctgttttgtccaatcagaagccaacggctcagggcctgctgcgg
ccggcaactcatgggcatcagaccagcaaaccacagggaccaaatgagaatcgcaatcca
cagcagacaagccattcctccactccaaacatggaaaagaaaggaagcaccgatcaagga
aagactttggctgttcccaaagaggagggtaaaaagaaacaatggtgtctggaagacttt
gaaatcggacgacccctaggcaaagggaagttcggaaatgtgtatctggcacgtgagcgg
gagagtaaattcatcctggcactgaaagtgttgtttaaatcccagcttgagaaggcggga
gtagagcaccagctacgccgggaggtggaaattcagtcccatctcaggcacccgaatatc
ctccggctatatggctatttccacgatgcctgcagagtctacctaatcctcgattatgcg
cctggtggggaactattcagagagctgcagaaatgcaccagatttgacgaccaaaggagt
gctttgtacatcaaacagctggcagaagccctcctgtactgtcactccaagaaggtgata
cacagggacattaaaccagagaatttgctgctcggctctaatggagaactgaagattgct
gactttggctggtctgtgcatgctccgtcctccaggaggaccactctgtgtggaactctg
gattatctacctcctgagatgatcgagggccgaatgcacgacgagaaagttgacttgtgg
agtctgggagttctctgttacgaattccttgtagggaaacctccatttgagactgacacc
caccaggaaacctacagacgcatttcaaaggttgaatttcaatatccgccgtatgtatcg
gaagaggcaaaagatctcgtttcgaagctgttaaagcacaacccaaaccacaggctgccc
ctgaaaggagttctcgaacatccatggatcgtaaaaaattctcaacaacccaagaagaaa
gatgagccacttgcaggtgctcagtag

DBGET integrated database retrieval system