KEGG   Xenopus laevis (African clawed frog): 398349Help
Entry
398349            CDS       T01010                                 

Gene name
aurka.S, ARK-1, Aurora-A, Eg2, aik, ark1, aur-a, aura, aurka-b, aurora2, btak, pEg2, stk15, stk6, stk7
Definition
(RefSeq) aurora kinase A S homeolog
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    398349 (aurka.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398349 (aurka.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398349 (aurka.S)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   398349 (aurka.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     398349 (aurka.S)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    398349 (aurka.S)
   Spindle formation proteins
    398349 (aurka.S)
  Sister chromatid separation proteins
   Aurora kinases
    398349 (aurka.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
9_10S
AA seq 408 aa AA seqDB search
MERAVKENHKPSNVKVFHPMTEGPKRIPVSQPPSTQVRPPVTGVSAQRILGPSNVPQRVM
MQAQKPVLSNQKPTAQGLLRPATHGHQTSKPQGPNENRNPQQTSHSSTPNMEKKGSTDQG
KTLAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAG
VEHQLRREVEIQSHLRHPNILRLYGYFHDACRVYLILDYAPGGELFRELQKCTRFDDQRS
ALYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTL
DYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVS
EEAKDLVSKLLKHNPNHRLPLKGVLEHPWIVKNSQQPKKKDEPLAGAQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggctgttaaagagaaccacaaaccttctaatgtcaaggtttttcacccaatg
acggagggtcccaaacgtatcccagttagccagcctccgagcacccaggttaggcctcct
gtgactggagtctctgctcagaggatattgggtccctctaatgtgccccagcgggtgatg
atgcaggctcagaaacctgttttgtccaatcagaagccaacggctcagggcctgctgcgg
ccggcaactcatgggcatcagaccagcaaaccacagggaccaaatgagaatcgcaatcca
cagcagacaagccattcctccactccaaacatggaaaagaaaggaagcaccgatcaagga
aagactttggctgttcccaaagaggagggtaaaaagaaacaatggtgtctggaagacttt
gaaatcggacgacccctaggcaaagggaagttcggaaatgtgtatctggcacgtgagcgg
gagagtaaattcatcctggcactgaaagtgttgtttaaatcccagcttgagaaggcggga
gtagagcaccagctacgccgggaggtggaaattcagtcccatctcaggcacccgaatatc
ctccggctatatggctatttccacgatgcctgcagagtctacctaatcctcgattatgcg
cctggtggggaactattcagagagctgcagaaatgcaccagatttgacgaccaaaggagt
gctttgtacatcaaacagctggcagaagccctcctgtactgtcactccaagaaggtgata
cacagggacattaaaccagagaatttgctgctcggctctaatggagaactgaagattgct
gactttggctggtctgtgcatgctccgtcctccaggaggaccactctgtgtggaactctg
gattatctacctcctgagatgatcgagggccgaatgcacgacgagaaagttgacttgtgg
agtctgggagttctctgttacgaattccttgtagggaaacctccatttgagactgacacc
caccaggaaacctacagacgcatttcaaaggttgaatttcaatatccgccgtatgtatcg
gaagaggcaaaagatctcgtttcgaagctgttaaagcacaacccaaaccacaggctgccc
ctgaaaggagttctcgaacatccatggatcgtaaaaaattctcaacaacccaagaagaaa
gatgagccacttgcaggtgctcagtag

DBGET integrated database retrieval system