KEGG   Xenopus laevis (African clawed frog): 398360Help
Entry
398360            CDS       T01010                                 

Gene name
xplcg1a
Definition
phospholipase C-gamma-1a
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    398360 (xplcg1a)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    398360 (xplcg1a)
   04370 VEGF signaling pathway
    398360 (xplcg1a)
   04020 Calcium signaling pathway
    398360 (xplcg1a)
   04070 Phosphatidylinositol signaling system
    398360 (xplcg1a)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     398360 (xplcg1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1274 aa AA seqDB search
MESLPLLNGFAPSGQSEAELTHLCRSLEVGTVMTLFYSKKSQKPERRTFQVKLETRQVTW
SRGADKVEGAVDIREIKEIRASKNSRDFDRYQEDPTVRLEQAHCFVILYGTEFRLKTLSL
QATSEEEVNMWIKGLNWLLQDTLQAPTPLQIERWLRKQFYTLDRNREDKISVKDLKNMLS
QVNYRVPNMRFLRDRLTELEQRSREINYAQFAMLYRSLMYDAQKTIPIPFTETFGERERT
KISLEDFQKFLLDYQKDMWATDLHKVREFMFHFLHDPLREIEEPYFTLEEFVTFLFSKEN
TVWDLELDTVCPQNMDNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELD
CWDGPDGMPVIYHGHTLTTKIKFSEVLSTIKEHAFVTSEYPVILSIEDHCSIAQQRNMAQ
HFKKVFGDMLLTKPVDVNADGLPSPNQLKRKILIKHKKLAEGSTYEEIPSSTVYSENDIS
NSIKNGILYLQDPINHEWYPHFFVLTSSKIYYSEETTGNQANDDEEEQKEASNSSELHSA
EKWFHGKLGAGRDGRHIAERLLTDYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQH
CRIHSRQEAGSPKFFLTDNLVFESLYALITHYQQMPLRCNEFEMRLTEPVPQTNAHESKE
WYHASLTRGQAEHMLMRVPRDGAFLVRKRSEQNSYAISFRAEGKIKHCRVIQEGQSVVLG
SSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTPDPDYGALYEGRNPGFYVEAN
PMPTFKCSVRALFDYKAQREDELTFTKNTIIQNVEKQEGGWWRGDCGGKKQMWFPANYVE
EIFSPPEPEPERQHLDDNSPLGDLLGGVLDVPSCHIVPRQDVFNGRPFVFIITGPQLNRY
PLDVAADTLEDMQDWIRKIREAAQTADARLTEGKIMERRKKIALELSELVIYCRPVPFDE
EKIGTEKACYRDMSSFPETKAEKYVNKMKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLT
MWICGSQLVALNFQTPDKPMQMNQALFQSGGRCGYVFQPNCMRDEMFDPFDKGTLLLETI
TISIEILGARHLPKIGRGIVCPFVEVEVCGTEYDNAKQKTEFVVDNGLNPVWPQKTFSFV
VANPEFAFLRFVVYDEDMFSDQNFLAQASFVVRGLKTGYRAIPLKNNYTEDLELALLLIK
IDIKTENGELNGASAPRERISDPMSGRIWDGPTETRYHSNHLDDFRTSQEQLSEHFERER
RVLRKTRLSGDNRL
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgcctcttctcaatggattcgctccaagtgggcaaagtgaagcggagctc
acccatctgtgccggagtttggaggtgggcaccgtcatgaccctcttctactcaaagaag
tctcaaaagccagagaggaggaccttccaggtgaagctggagaccaggcaggttacatgg
agtagaggggcagataaagtggaaggggcagtggatatcagggaaattaaggagattcga
gctagcaagaactcaagagattttgaccggtaccaagaggatccgactgtgaggttggag
caggctcactgctttgttatattgtacggaacagagttcagactaaagaccttgagccta
caagccacctccgaggaggaagtaaacatgtggattaaagggttaaactggctgcttcag
gatacgctgcaggctcctactcctctgcagattgagaggtggctccggaagcaattctac
acattggaccggaacagggaagacaagatttctgtcaaagacttaaagaatatgctgtcc
caggttaattacagggtccccaacatgaggttcctgcgtgaccgactaacggaactggaa
caaaggagccgagagattaactatgcccagtttgccatgctctaccgatctcttatgtat
gatgcacagaaaacgataccaattcccttcacagagacatttggagagcgtgaaaggacc
aaaatatccttagaggactttcaaaaattcctgctggattatcaaaaggatatgtgggca
actgatctgcacaaagtgcgggagtttatgttccacttcttacatgaccctctgagggag
atcgaagagccatatttcactctggaagagtttgtcactttcctgttctctaaggagaat
acagtgtgggatttagaactggacacagtgtgtccccaaaatatggacaaccctttgtct
cattactggatatcctcttcccacaacacatacctaacaggggatcagttctccagtgaa
tcttcattggaagcctacgctcgctgcttgcgcatgggctgccgctgcatagaattggat
tgctgggatgggccagacgggatgccagttatttaccatgggcatacgctgaccaccaaa
ataaagttctcagaagtcttgagcaccatcaaggaacatgcttttgtcacttcagaatac
cctgttatcttatcaattgaagaccactgcagcattgcacaacaaagaaatatggctcag
cactttaagaaggtttttggggacatgcttctgacaaagcctgtggatgtcaatgcagat
ggccttccctctcccaaccaactaaaacgaaaaatcctcatcaagcacaagaagctggca
gaaggcagcacttatgaagagataccgtcctccacagtctactctgagaatgacatcagc
aactccatcaagaatggaattttgtacctgcaagatcccatcaaccatgagtggtaccca
catttctttgtcctcaccagcagcaagatctattattcagaggagaccactggcaaccag
gctaatgatgatgaggaagaacagaaggaggccagtaacagctcagagttgcactctgct
gaaaagtggttccacggaaagctgggtgcaggaagggatggacggcacattgctgaacgt
ctgctgacagattactgtattgaaactggggctccagacggctcctttctggtgcgggaa
agtgagacgtttgtgggggattacacactctccttctggagaaatggaaaagtccagcat
tgtaggatacactcgaggcaagaagctgggagtcccaaatttttcctgacagataacctg
gtgtttgagagtctgtatgcactgattactcactaccagcaaatgcccctgaggtgcaat
gagtttgagatgcgactgacagaacctgttccacagaccaatgcccacgagagcaaggag
tggtaccatgccagcctcacccgggggcaagcagaacatatgttgatgagagttccacga
gatggagcctttttggtgcgtaagaggagtgaacagaactcttatgcaatctccttccga
gccgaaggaaagatcaaacactgccgggttatacaggaaggtcaaagcgttgtccttgga
agctccgaatttgacagcctagtggatctgataagttactatgagaagcatcctctgtat
cggaagatgaagctgcgttaccccattaatgaagaaacacttgaaaagattggcactcct
gatccagattatggagctctatatgagggaaggaaccctggtttctatgtggaggccaat
ccaatgcctacatttaagtgctctgtcagggccctgtttgattataaggctcaacgtgag
gatgaattgactttcaccaagaatacaatcatccagaatgtagagaagcaagagggagga
tggtggcgaggagactgtgggggtaaaaaacagatgtggttccctgctaactatgtggaa
gagatctttagtccacctgagcctgaacctgagaggcagcatctagatgacaacagtcct
ctaggagatctgttaggtggagttttggatgtgccatcctgtcacattgttccccggcag
gacgtttttaatggccgaccctttgtattcatcattactgggcctcagttaaaccgatat
cctcttgatgtcgctgcggacacactggaagacatgcaagactggataagaaaaattcgg
gaagcagctcaaactgctgatgcgcggctcacagaaggcaaaattatggagcgccgaaag
aagattgcccttgaactctcagaacttgtcatctactgccggccagtgccctttgacgaa
gagaagattggcactgaaaaggcctgttaccgtgacatgtcttccttccctgagaccaaa
gcagaaaagtatgtcaacaagatgaaagggaagaaattcctccagtacaaccggcggcag
ctatctcgtatctatcccaaaggacaacgactcgattcatcaaactatgaccccctgaca
atgtggatctgtggcagtcaactcgtagcgctcaacttccagacaccagacaaacccatg
caaatgaaccaggctcttttccagtccgggggccgttgcggttatgtttttcagccaaac
tgcatgagggatgaaatgtttgatccgtttgacaaaggcactctgcttctagagacaata
accatcagcattgagatccttggtgcccgccatctgccaaagattggaaggggtattgtc
tgcccttttgtggaggtagaagtttgtggtactgaatatgacaatgcaaagcagaagaca
gaatttgtagtggataatggcttaaaccccgtctggccacagaaaaccttctcctttgtc
gttgctaaccctgaatttgctttcctacggtttgtggtctatgacgaggacatgtttagt
gatcagaacttcttggctcaagcctcatttgtggtccgtggcttaaaaacaggatataga
gccatcccactcaaaaataactacactgaagatctggaactggcattactgctcattaag
atagacatcaagactgagaatggagaactcaatggagcttctgcacccagagaacggatc
agtgaccccatgtctggacgaatttgggatgggccgacagagacaagatatcattccaat
catttggacgactttcgcacctcgcaagaacagttgtcggaacactttgagagagaaagg
agagtcctcaggaaaacacgtctgagtggggataaccggctgtag

DBGET integrated database retrieval system