KEGG   Xenopus laevis (African clawed frog): 398592Help
Entry
398592            CDS       T01010                                 

Gene name
mapk12, Xp38gamma, sapk3
Definition
mitogen-activated protein kinase 12 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    398592 (mapk12)
   04370 VEGF signaling pathway
    398592 (mapk12)
   04068 FoxO signaling pathway
    398592 (mapk12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    398592 (mapk12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    398592 (mapk12)
   04621 NOD-like receptor signaling pathway
    398592 (mapk12)
   04622 RIG-I-like receptor signaling pathway
    398592 (mapk12)
  Endocrine system
   04912 GnRH signaling pathway
    398592 (mapk12)
   04914 Progesterone-mediated oocyte maturation
    398592 (mapk12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    398592 (mapk12)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    398592 (mapk12)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     398592 (mapk12)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   398592 (mapk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 363 aa AA seqDB search
MSTSPLPRKGYYTQEVNKTVWEVKERYRELLAVGSGAYGIVCSSLDTRTGTKVAIKKLYR
PFQSELFAKRAYRELRLLKHMQHENVIGLLDVFTPDTNLDKFNDFYLVMPFMGTDLGKIM
KHEKLSEDRIQFLVYQILRGLKYIHSAGIIHRDLKPGNLAVNEDCELKILDFGLARHTDS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMYTGRPLFKGNDHLNQLTEIMK
ITGTPTQDFVQKLQSTDAKNYIKSLPKVQKKDFGSLLRYANPLAVNILEKMLVLDAEKRI
TATEALAHAYFEQFHDIDDETEAEPYDDSFDNVNLPLEEWKRLTHEELTSFEPLVADSKE
TSV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctccccgctgcccaggaagggatactatacccaggaggtgaataagactgtg
tgggaggtgaaggagaggtacagagagctgctggctgtgggctcaggagcctatggtatt
gtttgctcatctcttgacactaggactggaacaaaggtagctatcaagaaactgtaccgt
ccttttcaatcggaactctttgcaaaacgagcttatagagaactgaggcttttgaagcac
atgcagcatgaaaacgtaattggattattggatgtttttactccagacacaaatttggat
aaattcaatgatttttatttggtgatgccattcatgggtacagaccttggcaagataatg
aaacatgaaaagctatcagaagaccgaatccagtttctggtttaccagatcctcaggggg
ctaaagtacattcattcagctggcataatccacagggatttaaaacctggaaatcttgca
gtaaatgaagactgtgaattaaagattctggattttggcctggcaagacacacagacagt
gaaatgactggttatgtggtgaccagatggtacagagccccagaggtgatactcaattgg
atgcactacactcagacagtggatatctggtcggttggctgtatcatggcagagatgtac
accgggaggccactgttcaagggaaatgaccatctgaatcagctaacagaaatcatgaaa
attactgggacaccaactcaggattttgtccagaagctccagagtactgatgctaaaaac
tatatcaagagtctccctaaagtgcagaagaaagactttggatcattgctaagatatgca
aaccctcttgctgtaaatatccttgagaagatgttggtgctggatgcagagaagaggata
actgccacagaggctttagcacatgcttactttgagcagttccatgatattgatgacgag
actgaagcagaaccctatgatgattcatttgacaatgtaaatcttcccctggaggaatgg
aaacggctcacacacgaggagctcactagctttgagccattggtggccgattcaaaggaa
acttcggtataa

DBGET integrated database retrieval system