KEGG   Xenopus laevis (African clawed frog): 398635Help
Entry
398635            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC64293
  KO
K05759  
profilin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    398635
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    398635
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   398635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MSWNGYIDNLTCEKVQEACICGYKGTPSVWACTPGGVFSNITPAEINALVSPNRESLFVN
GLTIGGVKCSVLRDEFAVVDNQVMDLRTKNPNGPTYNVSICKTEQALVMVMGKAEVHGGC
LNKKVFDMGKYLRCSGY
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaacggctacatcgataacctgacgtgcgagaaagtgcaggaggcgtgtatc
tgcggctacaaggggaccccgtccgtatgggcctgcactcccggcggagtcttcagcaac
ataacgcctgctgagatcaatgcgttggtgtcgcccaaccgagagtcgctatttgtcaat
ggtctgaccataggcggagtcaagtgctccgtgctcagggacgagttcgctgtggtcgac
aaccaggtgatggatctgaggaccaagaaccccaacgggcccacctacaatgtctccatc
tgcaaaactgagcaagctctggtcatggtcatggggaaggccgaggtgcacggggggtgt
ctgaacaagaaagtctttgacatgggcaagtacctgagatgttctggctactga

DBGET integrated database retrieval system