KEGG   Xenopus laevis (African clawed frog): 398635Help
Entry
398635            CDS       T01010                                 

Definition
uncharacterized protein MGC64293
Orthology
K05759  
profilin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xla05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MSWNGYIDNLTCEKVQEACICGYKGTPSVWACTPGGVFSNITPAEINALVSPNRESLFVN
GLTIGGVKCSVLRDEFAVVDNQVMDLRTKNPNGPTYNVSICKTEQALVMVMGKAEVHGGC
LNKKVFDMGKYLRCSGY
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaacggctacatcgataacctgacgtgcgagaaagtgcaggaggcgtgtatc
tgcggctacaaggggaccccgtccgtatgggcctgcactcccggcggagtcttcagcaac
ataacgcctgctgagatcaatgcgttggtgtcgcccaaccgagagtcgctatttgtcaat
ggtctgaccataggcggagtcaagtgctccgtgctcagggacgagttcgctgtggtcgac
aaccaggtgatggatctgaggaccaagaaccccaacgggcccacctacaatgtctccatc
tgcaaaactgagcaagctctggtcatggtcatggggaaggccgaggtgcacggggggtgt
ctgaacaagaaagtctttgacatgggcaagtacctgagatgttctggctactga

DBGET integrated database retrieval system