KEGG   Xenopus laevis (African clawed frog): 398732Help
Entry
398732            CDS       T01010                                 

Gene name
usp5-a, USP5, isot
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     398732 (usp5-a)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   398732 (usp5-a)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   398732 (usp5-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 832 aa AA seqDB search
MADVKDALVSVLPTIRVPRAGDRVHKDECAYSFHTPETDSGLYICMNTFLGFGRPYVEQQ
YNKTGQRAFLHVKRTPKMKSDESNSGTGDPPRKKPTRLAIGMEGGFDMSEEQCEYEEVLK
LVILPEFLEIPRDGLLGLPDMVRDRVTSAIDAILSADSASRKQDIQAWDGEVRQVSKHAR
NLQQLEGVPRIPPCGWKCSVCDLRENLWLNMTDGAIFCGRRYFDGSGGNNHALQHYQETG
FPLAVKLGTITPDGGDVYSYDEDDMVLDPNLAEHLSHFGIDMMKMQKTDKTMTELEIDMN
QRIGEWEVIQESGVQLQPLYGSGYTGIQNLGNSCYLNSTMQVLFSIPAFQRKYVDRMEHI
FRKSPADPTQDFNTQVAKLGNGLLSGEYSKPALEKDNDTAPEHKGLQDGIAPRMFKALVG
KGHPEFSTNRQQDAQEFFLHFINMIERNCRSSSNPNEVFRFLVEEKIKCLVSQKVKYTQR
VEYMLQLPAPMEAALNKEELSAYEQCRLQAEREHRPPPEIVRARIPFTSCLEAFAAPEQL
DEFWSAALQAKSNALKTSRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEVPDELDLSEF
RGGGLQGGEEELPDVAPPLVTPDEPKAPVLDESVVTQLVEMGFPAEACRKAVYYTGNSGA
EAAMTWVMSHMDDPDFALPLSGASAPSSVSTGGDPPSEEHVATIISMGFSQDQAVKALRA
TNNNLERAVDWIFSHIDDLDAEAAMDFSEGRSAAESVSESVPAAGPRVRDGAGRYELFAF
ISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIYFYQRIQS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtgaaagatgctctagtttctgtgctgccgaccattcgggtacctcgtgct
ggggaccgagtgcacaaggatgaatgtgcctattccttccatactccggaaacagacagc
ggattatatatttgcatgaatacatttctgggatttgggagaccctatgttgagcagcaa
tacaacaagactgggcagagggcctttctgcatgtcaagagaactcctaaaatgaaatcc
gatgaatccaattctggcacaggtgaccctccacgcaagaagccgactcgcttagccatt
ggaatggagggtggctttgacatgagcgaggaacagtgtgagtatgaggaagtgctgaag
ctggtcattctgcccgagtttctggagattccacgggatggactgttggggctcccggat
atggtcagggatcgggtaacgtctgctattgatgccatactgtctgctgactctgcctcc
cggaaacaggacattcaggcctgggatggggaagtgaggcaggtctccaaacatgcacgc
aatctgcagcagcttgagggagttcctcgtattccaccatgcggatggaagtgcagtgta
tgtgacctgcgggagaatctgtggctcaatatgacagacggcgctatcttttgtggaaga
cgttactttgacggcagtggcggaaataaccatgcgttacagcactaccaagaaacaggc
ttccctttagcagtgaaactaggcaccattacacctgatggaggcgatgtctattcctat
gatgaggatgatatggttctggaccctaacctggcagagcatctctcacactttggtatt
gatatgatgaagatgcagaagacggataagaccatgacagaactggaaatcgacatgaac
caacgaattggggagtgggaggtgattcaggaatcgggtgtacagttgcagcccctctat
ggctcagggtacactggcatccagaaccttggaaacagctgctacctcaattcaaccatg
caagtcctcttcagcatccctgccttccaacgcaaatatgttgaccgtatggagcatatt
ttccggaaatctcctgctgatccaacacaagacttcaacacccaagtggccaagcttgga
aatggtctgttatctggggaatactcaaagccagctctagagaaagacaatgacacagct
ccagaacataagggccttcaggatgggatcgctccaagaatgtttaaggcacttgttggg
aagggacaccctgagttttccaccaacaggcaacaagatgctcaggaattcttcctgcac
tttataaatatgattgagagaaactgccgcagctcatccaaccctaatgaagttttccgt
tttctggtggaggagaagattaagtgtctggtgtctcagaaagtgaagtatacacagagg
gttgagtacatgctgcaacttcctgcgcccatggaggctgcactcaataaggaggagctg
tctgcatatgagcaatgccgactccaggctgaacgtgagcatcgcccccctccagaaata
gtccgggcacgtattccattcacatcttgtttagaggcatttgctgcccccgagcagctc
gatgagttctggagcgccgctcttcaggccaaatccaatgcactcaagacttcccgcttt
gcctcatttcccgattacttggtcattcaaatcaagaagttcacttttggccttgactgg
gtacccaagaaactggatgtctctattgaagtcccagatgaattggatctttctgaattt
cggggtggggggcttcaagggggggaagaggagctcccagatgttgcccccccattggtc
acacccgatgagcccaaagctccagtgctggatgagtcggtggttacacagttggtagag
atgggattcccagcagaggcgtgccgtaaagctgtctattacacaggcaacagcggggca
gaggctgctatgacgtgggtgatgtcacacatggatgacccagattttgccttgcctctg
tctggggctagtgcaccctcatcagttagtaccggaggggatccaccctctgaggaacat
gttgcaacaataatatccatgggcttctcccaggaccaagcagtgaaagctctccgtgcc
actaacaacaacttggaacgtgctgtcgactggatcttctctcacatcgatgacttggat
gctgaggctgccatggatttctctgagggtcgctctgctgcagagtctgtctctgaaagt
gtccctgctgcgggacctcgtgtgagggatggagctggcagatatgagctttttgccttc
atcagtcacatgggcacgtccaccatgtgcggtcactacgtgtgtcatataaagaaggaa
ggaagatgggtgatctacaacgatcagaaagtctgtgcttcagagaagcctcccaaagac
ctgggatacatttacttctaccaacgtatacagagttaa

DBGET integrated database retrieval system