KEGG   Xenopus laevis (African clawed frog): 398772Help
Entry
398772            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC68756
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    398772
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    398772
   04217 Necroptosis
    398772
   04218 Cellular senescence
    398772
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     398772
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C2: calpain family
   398772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
5L
AA seq 704 aa AA seqDB search
MMPFGGIASKLKIDRLKASGVGSHDCAIKYQNQDYESLKQQCLESGILFEDPHFPATPSS
LGFKELGPGSSKTRGVQWKRPSEIVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQSFQEEYAGIFHFQIWQFGEWVDVVIDDRLPVKDGELVFVHSAECTEFW
SGLLEKAYAKLNSSYESLSGGSTTEGFEDFTGGVAEMYELRKAPRDLDKIIKRALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTALKEVDYRGGMEKLIRIRNPWGQVEWTGAW
SDNSSEWNEVDPSEQEDLQLKMEDGEFWMSFQEFLRQFSRLEICNLTPDALNKDGLGKWH
TTLYDGTWRRGSTAGGCRNNPATFWINPQFKITLMEEDDDPDDNELACSFLVALMQKNRR
KEMKAGQDTHTIGFAVYEVPDEFKGCQNVHLKKDFFLRHQSCARSETFINLREVSTQIRL
PPGEYIIVPSTFEPHKEADFIIRIFTEKHSDTQELDEEVSADLPDEEELTEDDVDDSFKA
MFQHLAGDDMEISVFELKTILNRVVAKHKDLKTDGFGMEACRQMVNLMDKDGSGKLGVLE
FQILWNKIRNWLTVFRQHDLDKSGTISAYELRIALESTGYKLNNKLIQVLVARYADSDMG
IDFDNFVCCLVKLEAMFRFFKALDQGDGTAEMNLGEWLTMTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtttgggggcatagcatccaaactcaagatcgaccgcctgaaggcatctggc
gtgggctcacatgattgcgccataaagtaccagaaccaggattatgagagtctgaaacag
cagtgtctggagagtggcatcctcttcgaagatccacatttcccagccactccctcttcc
ttgggcttcaaggaactgggccctggatccagcaaaactaggggagtgcaatggaagcga
ccctcagaaattgttgatgacccacagtttattgttggtggagcaaccaggacagacata
tgccagggggcactgggggactgttggctcctggctgccattggctctctgacgctgaat
gaggatttgctgcacagagtggtaccgcatgggcagagcttccaggaggaatatgctggg
atattccacttccagatctggcagtttggtgagtgggtcgatgtggtgatagatgaccgt
ttgccagtaaaggatggagagctggtatttgtgcactcagccgagtgtactgagttctgg
agtggtctactggaaaaggcctatgccaagctgaacagttcgtatgagtccctgtctggt
gggagcaccactgagggatttgaggactttaccggaggagttgcagaaatgtacgaatta
cgcaaagcacctcgagacttagataagattataaaacgtgctttggagagagggtccctt
ctgggatgttcaatagatataacaagtgcctttgacatggaagctgtcacatttaagaag
cttgtgaagggacacgcatactcagtcactgctctcaaagaggttgattacagaggagga
atggaaaagctcattcgcatcagaaatccctgggggcaggtggaatggaccggagcctgg
agtgataattcgtcggaatggaatgaagtggacccttcagagcaggaggacttgcagctg
aagatggaggatggagagttctggatgtctttccaagaattcctgcgccagttttcccgt
ctggagatctgtaacctgaccccggatgctttgaataaagacgggctcggcaagtggcac
accactctgtatgatggcacttggcgccgcggaagcaccgccgggggctgcaggaacaac
ccagccacattttggatcaaccctcagttcaaaattaccctgatggaggaagatgatgac
cctgatgacaatgagttggcctgcagtttcctggtggcgctgatgcagaagaaccggcgg
aaggaaatgaaggcaggacaagacacgcacaccattggctttgctgtgtatgaggttcct
gatgagtttaagggctgccagaatgtgcatctgaagaaagatttcttcctacgccaccaa
tcctgtgcccgctctgaaacctttatcaacctgcgtgaggtcagcacgcagatccgcctg
ccccctggggagtacatcattgttccttcgaccttcgaaccccacaaggaggcagacttt
atcatccgaatattcactgagaaacattcagatacacaggagctggatgaggaggtatct
gcagatcttcctgatgaggaggaactcacagaagacgatgtggatgattcattcaaggcc
atgttccagcacctagcaggagatgacatggagatcagtgtgtttgagctgaagacaatc
ctgaaccgagtggtggccaaacacaaagatctgaagacggacggttttggtatggaggcc
tgtaggcagatggtcaatctgatggataaagatggcagcggcaagctgggagttctggag
tttcagatcctgtggaacaaaattcggaattggctcactgttttccgacaacacgacctg
gataagtccggcaccatcagcgcctatgagctgcgcatagccctggagagtacagggtac
aaattgaataacaagcttattcaggtcctggtcgctcgctatgcggattccgacatgggc
atcgattttgataactttgtgtgctgtctagtgaagctggaggccatgttcaggtttttc
aaggcattggaccaaggcgatggcacagcagagatgaatctgggagagtggctgacgatg
accatgtgcggataa

DBGET integrated database retrieval system