KEGG   Xenopus laevis (African clawed frog): 398772Help
Entry
398772            CDS       T01010                                 

Definition
uncharacterized protein MGC68756
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 704 aa AA seqDB search
MMPFGGIASKLKIDRLKASGVGSHDCAIKYQNQDYESLKQQCLESGILFEDPHFPATPSS
LGFKELGPGSSKTRGVQWKRPSEIVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQSFQEEYAGIFHFQIWQFGEWVDVVIDDRLPVKDGELVFVHSAECTEFW
SGLLEKAYAKLNSSYESLSGGSTTEGFEDFTGGVAEMYELRKAPRDLDKIIKRALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTALKEVDYRGGMEKLIRIRNPWGQVEWTGAW
SDNSSEWNEVDPSEQEDLQLKMEDGEFWMSFQEFLRQFSRLEICNLTPDALNKDGLGKWH
TTLYDGTWRRGSTAGGCRNNPATFWINPQFKITLMEEDDDPDDNELACSFLVALMQKNRR
KEMKAGQDTHTIGFAVYEVPDEFKGCQNVHLKKDFFLRHQSCARSETFINLREVSTQIRL
PPGEYIIVPSTFEPHKEADFIIRIFTEKHSDTQELDEEVSADLPDEEELTEDDVDDSFKA
MFQHLAGDDMEISVFELKTILNRVVAKHKDLKTDGFGMEACRQMVNLMDKDGSGKLGVLE
FQILWNKIRNWLTVFRQHDLDKSGTISAYELRIALESTGYKLNNKLIQVLVARYADSDMG
IDFDNFVCCLVKLEAMFRFFKALDQGDGTAEMNLGEWLTMTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtttgggggcatagcatccaaactcaagatcgaccgcctgaaggcatctggc
gtgggctcacatgattgcgccataaagtaccagaaccaggattatgagagtctgaaacag
cagtgtctggagagtggcatcctcttcgaagatccacatttcccagccactccctcttcc
ttgggcttcaaggaactgggccctggatccagcaaaactaggggagtgcaatggaagcga
ccctcagaaattgttgatgacccacagtttattgttggtggagcaaccaggacagacata
tgccagggggcactgggggactgttggctcctggctgccattggctctctgacgctgaat
gaggatttgctgcacagagtggtaccgcatgggcagagcttccaggaggaatatgctggg
atattccacttccagatctggcagtttggtgagtgggtcgatgtggtgatagatgaccgt
ttgccagtaaaggatggagagctggtatttgtgcactcagccgagtgtactgagttctgg
agtggtctactggaaaaggcctatgccaagctgaacagttcgtatgagtccctgtctggt
gggagcaccactgagggatttgaggactttaccggaggagttgcagaaatgtacgaatta
cgcaaagcacctcgagacttagataagattataaaacgtgctttggagagagggtccctt
ctgggatgttcaatagatataacaagtgcctttgacatggaagctgtcacatttaagaag
cttgtgaagggacacgcatactcagtcactgctctcaaagaggttgattacagaggagga
atggaaaagctcattcgcatcagaaatccctgggggcaggtggaatggaccggagcctgg
agtgataattcgtcggaatggaatgaagtggacccttcagagcaggaggacttgcagctg
aagatggaggatggagagttctggatgtctttccaagaattcctgcgccagttttcccgt
ctggagatctgtaacctgaccccggatgctttgaataaagacgggctcggcaagtggcac
accactctgtatgatggcacttggcgccgcggaagcaccgccgggggctgcaggaacaac
ccagccacattttggatcaaccctcagttcaaaattaccctgatggaggaagatgatgac
cctgatgacaatgagttggcctgcagtttcctggtggcgctgatgcagaagaaccggcgg
aaggaaatgaaggcaggacaagacacgcacaccattggctttgctgtgtatgaggttcct
gatgagtttaagggctgccagaatgtgcatctgaagaaagatttcttcctacgccaccaa
tcctgtgcccgctctgaaacctttatcaacctgcgtgaggtcagcacgcagatccgcctg
ccccctggggagtacatcattgttccttcgaccttcgaaccccacaaggaggcagacttt
atcatccgaatattcactgagaaacattcagatacacaggagctggatgaggaggtatct
gcagatcttcctgatgaggaggaactcacagaagacgatgtggatgattcattcaaggcc
atgttccagcacctagcaggagatgacatggagatcagtgtgtttgagctgaagacaatc
ctgaaccgagtggtggccaaacacaaagatctgaagacggacggttttggtatggaggcc
tgtaggcagatggtcaatctgatggataaagatggcagcggcaagctgggagttctggag
tttcagatcctgtggaacaaaattcggaattggctcactgttttccgacaacacgacctg
gataagtccggcaccatcagcgcctatgagctgcgcatagccctggagagtacagggtac
aaattgaataacaagcttattcaggtcctggtcgctcgctatgcggattccgacatgggc
atcgattttgataactttgtgtgctgtctagtgaagctggaggccatgttcaggtttttc
aaggcattggaccaaggcgatggcacagcagagatgaatctgggagagtggctgacgatg
accatgtgcggataa

DBGET integrated database retrieval system