KEGG   Xenopus laevis (African clawed frog): 398800Help
Entry
398800            CDS       T01010                                 

Gene name
dgat2
Definition
diacylglycerol O-acyltransferase 2 (EC:2.3.1.20)
Orthology
K11160  
diacylglycerol O-acyltransferase 2 [EC:2.3.1.20 2.3.1.75]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    398800 (dgat2)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     398800 (dgat2)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     398800 (dgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 361 aa AA seqDB search
MKTIIAAYSGVLRGTGSSLLSAVHDLPSIPWLSKSSVVRHLQIISVLQWVLSFLILGVAC
TAVLVYIFCTDLWLIAALYFTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPVKLVKT
HNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREY
LMSGGICPVNRDTINYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLLHRKGFVKVAL
QHGADLVPIYSFGENETYKQVVFEEGSWGRWIQQKFQKYVGFAPCLFHGCSFFSSNSWGL
VPYANPITTVVGEPITVPKIEQPTQKDVELYHSMYLSSLHRLFDKYKTKLGLPDSETLEF
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatcattgctgcctattctggggtcttacgcggcactgggtccagtctcctg
tcagcagtacatgacctgccctctatcccttggctgtccaaatcaagtgtggtgagacac
cttcagatcatctctgttctacaatgggttctcagcttcctcattttaggtgtggcgtgc
actgcagtccttgtgtacatcttctgcactgacctctggctgattgcagctttgtatttt
acatggatggtgcttgactggaatacaccatataaaggtggcagacgatcctcgtgggta
aggaactgggcagtctggcgctacttccgagactattttccagtaaagctggtaaaaaca
cacaacctcctgccaagcagaaactatatctttggctatcacccccatggaataatgtgc
cttggagccttttgtaacttcggtacagaagccaccggggtgtccaagaagtttcctggg
atcaagtgtcacctggccacgttggcgggaaatttcagaatgcctgtactgagggaatac
ttgatgtctggaggtatatgccctgtgaaccgggacaccattaactacattctgtccaag
aatggaactggcaacgctgttgttattgcggttgggggagctgccgaatctcttaactgc
agacctgggaagaacactgtaacactattgcacagaaaaggatttgtgaaagttgcactg
cagcatggagctgatcttgttcccatctactcgtttggtgaaaatgaaacttacaagcag
gttgtctttgaggagggatcttggggaagatggatacagcaaaagtttcagaaatatgtt
ggctttgctccatgtctcttccatgggtgcagcttcttctcctctaacagctgggggttg
gttccttatgccaatcctataacaactgttgttggagagccaatcacagttcccaagatt
gagcaacctacccagaaagacgtggagctctatcacagcatgtacttgtcatccctgcat
cgactttttgacaagtacaaaaccaaactcgggctcccagattcagaaaccctggaattc
atctga

DBGET integrated database retrieval system