KEGG   Xenopus laevis (African clawed frog): 398814Help
Entry
398814            CDS       T01010                                 

Definition
uncharacterized protein MGC68615
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    398814
   00052 Galactose metabolism
    398814
   00500 Starch and sucrose metabolism
    398814
   00520 Amino sugar and nucleotide sugar metabolism
    398814
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     398814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 508 aa AA seqDB search
MTSFPGGLRKAMAGGGLLQFQEAIREELEEAMKADLEKILSTAPESEIEHTKKDLAGFQK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPDNITSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVKQIEHLNTTYNTDVPLVLMNSFNTDEDTKKILQKYSH
CRVKIHTFNQSRYPRISKESLLPVAKDLSYSVENAESWYPPGHGDIYSSFYNSGLLDRLI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTDKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWVSLSAIKRLQEANAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLQAGSLTMSD
KREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctttccgggaggtttaaggaaagcaatggcaggcggtggactgttacagttc
caggaggccatcagagaggagttggaagaagccatgaaggcagacttggaaaaaattctc
tccacagcccctgaatcagaaatagagcacacaaagaaagacctggctgggtttcagaaa
ttgttccacagatttctacaggaaaaaggtccatcagtcgactggggaaagatccagaga
cctccggaggattctattcagccatacgagaagataaaggcgaaaggtctccccgataac
atcacgtccgtcctaaacaagctggttgtggtgaagcttaatggcggtttgggtacgagc
atgggctgcaaaggtcccaaaagcctgattggagttcggaatgaaaatactttcctagat
cttactgtgaagcaaatagagcacttgaatacaacgtacaacacagatgttcccctggtc
ctgatgaactctttcaacacagatgaagataccaagaaaatcctacagaaatacagtcac
tgtcgagtgaagattcatacttttaatcagagcaggtacccgaggataagtaaagagtct
ttattacccgttgccaaagacttgtcgtattctgtggaaaatgctgagagctggtacccg
cctggccacggtgatatctactccagcttttataattccggcctcctggacagactcatc
ggggaagggaaggagtacatctttgtttccaacattgacaatctcggggccacagtggat
ctttatatcctaaaccatctcatgaatccaccaaatggcaagagatgtgaatttgttatg
gaggtgacagacaaaacaagggctgatgttaagggtgggaccctcactcaatatgaaggg
aaactgaggctggtggaaattgcccaagtgcccaaagcccatgttgatgagtttaaatcg
gtctcaaagtttaagatcttcaacacaaataatttgtgggtttccttatctgcgatcaag
aggctacaagaagccaacgccatcgacatggaaatcatcgttaatcccaagactttggat
gggggattaaatgtgattcagctggagacggccgttggagcagctattaagagttttgaa
aattctttgggtataaatgttcctcgaagccgtttccttccagtaaagaccacgtcagac
cttctgcttgtcatgtccaacctgtacagccttcaggccggctccctgacgatgagcgac
aagcgagagttccccaccgtcccactcactaaactgggaagctcctttactaaggtacaa
gactacttgaagaggtttgaaagtatcccagatatgctggaactggatcacctcactgtg
tccggagatgtcacatttgggaaaaatgtttcacttaaggggactgtaattataattgca
aatcacggagacagaatcgacattcctcccggagccgtattagaaaacaagatcgtgtct
ggaaaccttcggatcctggatcactga

DBGET integrated database retrieval system