KEGG   Xenopus laevis (African clawed frog): 398823Help
Entry
398823            CDS       T01010                                 

Gene name
usp16
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     398823 (usp16)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   398823 (usp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 901 aa AA seqDB search
MVKKRGTNLPAQDFLDAEPVCKHLRKALDDGSVKRALVNVEWTMCQDCQADNKEKNNSED
ESAEDPSVWLCLKCGHRGCGRNSVAQHALNHYNTPRSEPHCLVLNVDMWSAWCYLCDNEV
PYNRTSRLGQLVDYLQRKAKAKNKNSNSVVSNEEVKTEIVTENEVKKIQYQDEKPDVQAK
QEKASSTQKISTEPTVKGLSNLGNTCFFNAVMQNLSQTPALSELLNEVKTFRKPVTVLLP
DSSSPKILEVNLEQQPGPLTLAMWQFLTEMHETKKGVVTPKELFSQVCKKAIRFKGYQQQ
DSQELLRYLLDGMRGEEIQRVTLAMSKSLQSTLDEEEIKKIVKDYEKRRTIPNFVDCLFG
GELTSTIMCEECHTVSLVHEPFLDLSLPVLDDLIVKKNSKSTPPARERKEEEEEEENDDD
RYVKERDEVSPGASKHLQKKAKKAAKKQAKNQRRQQKWQGKTVLFTDLAKQECSEDEEEV
SQTKTNTRPDNETPTADGLNTMETDLSTLENGNEESADGLNTMETDLSTLENGNEEMAGG
FKTMEMDLSTLENGSETIKSAVEGITEHTDLDSSVHNNVGSVETNALVGNMENNNNIEVN
KTPERTAGSGGDSMEAMAAVENGNADAVNVDDTEAVNGLIDSANMDHELTNSLNRLQLSS
DLEPTQVEIEILPDKEQPHTQVYEVVNEDPKTAFSTLSNRKDLPIDEFSVLSCLYQFTHK
ETLTGNNKLLCNVCTRKQASRLNNSNKGEKKFVYTNAKKQMLVSNPSPILTLHLKRFQQN
GFNLRKINRHIKFPEVLDLAPFCTAKCKNVPEGESRLLYSLYGVIEHSGSMRSGHYTAFV
KLRHPNQQLCKMLFTGVIPEVSGSEPGQGSWYHISDSHVQAVSLSRVLSSQAYLLFYERM
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagagagggacgaacctccccgcccaggactttcttgatgcagaacctgtg
tgcaagcacctgcggaaggccctggatgatggaagtgtgaagagggcgctggtgaatgtg
gaatggacaatgtgccaggactgccaggcagacaacaaggagaagaataactcagaggat
gagtcggctgaagacccttctgtctggctgtgtttaaaatgtggacatcggggctgtggc
agaaattcagtggcccagcatgcactgaaccattacaacacccccaggtcagaaccacac
tgcctggtccttaacgttgatatgtggagtgcatggtgctacttatgcgacaatgaggtt
ccctataaccgcactagtcggttaggccagctggtggattatttgcaaagaaaagccaag
gcaaaaaacaaaaattctaattcagtagtctcgaatgaagaagttaaaactgaaatcgtg
actgagaatgaagtcaagaagattcagtatcaagatgagaagcccgatgttcaagccaaa
caggaaaaagccagcagtacccagaaaattagtaccgagcctacagtgaaaggacttagc
aatttggggaacacgtgttttttcaatgcagtgatgcagaacctatcccagacccctgct
ttaagcgaacttctaaatgaggttaaaacatttagaaaaccagtgactgtcctactgccg
gattcatcatctcctaaaattctagaggtaaatctagagcagcagccaggaccactgacc
ttggcaatgtggcaattcctgactgaaatgcatgagacaaaaaagggagttgtcaccccc
aaggagctcttttctcaggtctgtaaaaaagcaatacggtttaaaggctaccagcaacaa
gatagtcaggaattacttcgctacttgttggatggaatgagaggagaggaaatccagaga
gtaaccttggcaatgtccaagtcactacagagcactttagatgaagaagaaattaaaaag
attgtgaaagattatgaaaagcgtcgaacgattccaaactttgtagactgtttgtttggg
ggagagctgactagcacaatcatgtgtgaggagtgccacacggtgtcattggttcatgaa
cctttccttgacctctctctgcctgtgctggatgatttgattgttaaaaaaaatagtaag
tcaacaccgccagctcgggagaggaaagaggaggaggaagaagaagagaatgatgatgac
cgctatgtgaaggaaagagatgaagtatcgcctggggcgagcaaacacctgcagaagaaa
gcaaagaaggcagctaaaaagcaagccaagaaccaacgcagacagcagaaatggcaaggg
aagacagtgctattcactgacttggccaagcaagagtgttcggaggatgaggaagaggtt
tcgcaaaccaagaccaacaccaggccagataatgagacccctacagccgatggcttaaac
acaatggaaacagatctgtccactcttgaaaacggcaatgaggaatcggccgatggctta
aacacaatggaaactgatttgtccactcttgaaaacggcaatgaggaaatggctggtggc
ttcaaaacaatggaaatggatctgtccactcttgaaaacggcagcgagactattaaaagt
gcggtagaaggaatcacggaacatacagaccttgattcttctgtgcataacaatgtgggg
agtgtggagacgaatgcacttgtgggtaatatggaaaataacaataacatagaagtgaat
aaaacccctgagagaactgcaggcagtggaggagacagcatggaagccatggccgctgtg
gagaatggaaatgctgatgcagtcaatgtggatgatacggaggctgtcaatggtttaata
gatagtgccaatatggatcatgaactaacaaactctttaaacagactccagctgagctct
gatctagaacccacccaggtagagatagagatattacccgacaaagagcagccccacacg
caagtctacgaggtggtaaatgaagaccccaaaactgcattcagtaccctttctaatagg
aaggatctgccaatagatgagttttctgtgctcagttgcctctatcagtttactcacaaa
gagaccctcactgggaacaacaagctgctctgtaatgtctgcacccggaaacaggccagc
aggctgaacaacagtaataaaggggagaagaagtttgtttacacaaatgctaagaagcaa
atgttggtgtcgaacccctctcccatcctcactctccatttgaagaggttccagcagaat
ggctttaatttacggaagattaacaggcatataaagttccctgaggtgctagacctggct
ccattctgcacagcaaaatgtaagaacgttcctgaaggagagtcgcggttactctattcc
ctgtacggcgttatcgagcacagcggcagcatgaggtccggccattacaccgcgttcgtc
aaactgcgtcacccgaaccagcagctctgcaagatgttatttaccggagtcattccagaa
gtctcgggaagtgaacctgggcaaggcagttggtaccacataagcgacagccacgtccaa
gcagtgtccctttccagagtgctgagctcccaggcttacctgctcttctatgagcgaatg
ctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system