KEGG   Xenopus laevis (African clawed frog): 398829Help
Entry
398829            CDS       T01010                                 

Gene name
dusp6, X17C, mkp3, pyst1
Definition
dual specificity phosphatase 6
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 378 aa AA seqDB search
MLEKLRPAAPLDMALGKSVSWLNEQLDVANERLLLMDCRAHELYESSHIEAAMNVAIPGI
MLRRLKKGNLPIRSLFACGEDRDKFARRCGTDTVVLYDENSCDWNENTAGESVLGLLMKR
LKDEGCRAFYLEGGFNKFQSEYPIHCETNLDSSCSSSSPPVLGLGGLRISSDSSSDIESD
IDRDPSSATDSDGSPLSNPQPSFPVEILPYLYLGCAKDSTNLDVLEEFGIKYILNVTPNL
PNLFENAGEFRYKQIPISDHWSQNLSQFFPEAISFIDEARGKSCGVLVHCLAGISRSVTV
TVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLY
FTNPANQNVYQVDSMQST
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctagagaagttgagacccgctgcgcccttggacatggcgctcggtaaatcggtgtcg
tggctgaacgagcagctggacgtggccaacgagcggcttcttctgatggactgcagggcg
cacgagctgtacgagtcgtctcacatcgaggcggccatgaacgtggccatcccgggcatc
atgctgcgccgcctcaagaagggaaacctgcccatccggtcgctctttgcctgcggggag
gaccgggacaagttcgcccgccgatgcggcaccgacacggttgtactgtacgacgagaac
agctgcgactggaacgagaacacggccggcgagtcggtgctggggctgctcatgaagcgg
ctgaaggacgagggctgcagggctttctacctggaaggtggattcaacaagttccaatct
gagtatcctatacattgtgaaaccaatctggatagttcctgtagcagtagctctccaccc
gtccttggtttgggaggcctccggatcagttctgactcttcgtcagatattgaatctgac
attgacagggatcccagcagtgcaacagattcagacggtagtcctctatccaaccctcag
ccatcatttcccgttgagatcttaccctacctttacctcggttgtgctaaggattctact
aacctggatgttttggaagagtttggcattaagtacatactgaacgtgacaccaaacttg
cctaatctttttgaaaacgcgggggaatttagatacaagcagattcccatttcggaccat
tggagccaaaacctgtctcagttttttccagaagccatctcgtttatagatgaagcccgg
ggtaaaagctgtggagtattggtgcattgcttggccggcatcagccgatcggttacagtc
actgtagcttatttgatgcagaagctgaacctctccatgaatgatgcctacgatattgtc
aagatgaagaaatccaacatctctcctaactttaacttcatgggtcagttgctggatttt
gaaaggacattggggcttagcagtccatgtgacaatcgagtcccagctcagcagttatat
tttacaaatccagccaaccaaaatgtatatcaagttgattctatgcagtccacgtga

DBGET integrated database retrieval system