KEGG   Xenopus laevis (African clawed frog): 398840Help
Entry
398840            CDS       T01010                                 

Definition
uncharacterized protein MGC68579
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 404 aa AA seqDB search
MKFARFLLKNAALANAPKQIERFSRFSPSPLSMKQFIDFGSANGCEKISFAFLRQELPVR
LANIMRELYILPDQLLGTPSVQLVQSWYIQSLMELIEFVEKDPEEQRVLSDFTEALVTIR
NRHNNVVPTMAQGVIEYKEAFGVDPVTNQNVQYFLDRFYMSRISIRMLINQHTLLFDGGT
NPAHPKHIGSIDPNCDVVEVVHDAFDTAKMLCEQYYLASPELRIKQTNGNDPSQPIHIVY
VPSHLYHMLFELFKNAMRATVESHETSPRLPPIKVNVVLGNEDVTIKISDNGGGVPLRKI
ERLFSYMYSTAPRPLMDNSRNAPLAGFGYGLPISRLYARYFQGDLMLHSMEGFGTDAVIY
LKALSSESVERLPVFNKSAWKHYKFSTEADDWCIPSSEPKNLAR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgcgaggttcctgctgaagaacgcagccttggcaaatgcacccaaacagatt
gagagattcagccgcttctccccttccccactctccatgaagcagttcatagactttgga
tctgctaatggctgtgagaagatatccttcgcattcctccgacaagagcttcctgtaaga
ctggccaacatcatgagggagctctatatacttcctgaccagttgctggggactccgtca
gtgcagcttgtccagagctggtacatacagagcttgatggagctaatagaattcgttgaa
aaagatccagaagagcaaagagtgctgtccgatttcacagaagcccttgtgacaatccgg
aacagacacaacaatgttgtccctacgatggctcagggagttattgaatacaaggaggca
tttggagtggatcctgtcaccaatcaaaacgttcagtattttcttgatcgcttttatatg
agccgcatttccataaggatgcttataaaccagcacactcttctttttgatggtggaacc
aacccagcccacccaaaacacatcggaagcatcgatccaaactgtgatgtggttgaggta
gtgcatgatgcttttgacactgccaagatgctttgtgaacagtactatttagcttctcct
gaattgagaataaagcagacgaatggaaatgatccttcccagccgattcatatagtttat
gttccatcgcatctctatcacatgctctttgagctttttaagaatgccatgcgggcaacg
gttgaaagtcatgaaactagtcctcgtctacctcctatcaaagtgaatgttgtcctagga
aatgaagatgtaactattaagatatcggacaatggaggaggcgttcccttgaggaagatt
gaacgactgttcagttatatgtattccacagcacccaggcctctgatggataattcacgg
aatgctcctttggctggttttgggtatggcttgcccatctctcgactttatgccaggtac
ttccagggagacttaatgctgcattcaatggagggcttcggaacagatgcagttatctat
ttaaaggcattatcatcggagtctgtagaaaggttacctgtcttcaacaagtctgcctgg
aaacattataaattcagcactgaagcagatgattggtgcattccaagtagcgaaccaaag
aacctggcaaggtag

DBGET integrated database retrieval system