KEGG   Xenopus laevis (African clawed frog): 398888Help
Entry
398888            CDS       T01010                                 

Gene name
ccnb2.L, C-B2, cyclinb2
Definition
(RefSeq) cyclin B2 L homeolog
  KO
K21770  
G2/mitotic-specific cyclin-B2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    398888 (ccnb2.L)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    398888 (ccnb2.L)
   04114 Oocyte meiosis
    398888 (ccnb2.L)
   04115 p53 signaling pathway
    398888 (ccnb2.L)
   04218 Cellular senescence
    398888 (ccnb2.L)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398888 (ccnb2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    398888 (ccnb2.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    398888 (ccnb2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
3L
AA seq 392 aa AA seqDB search
MATRRAAIPREADNILGGAMRSKVQIHGKRAALGEIGNKVTVRGKPHAVKQPSNVVAKPS
KTVATKVANVKPKPVLVKPTVAEAHTKVPSPVPMDVSMKEEELCQAFSDALTSVEDIDAD
DGGNPQLCSDYVMDIYNYLKQLEVQQSVRQCFLEGKEINERMRAILVDWLVQVHSRFQLL
QETLYMGVAIMDRFLQVQPVSRSKLQLVGVTSLLVASKYEEMYTPEVADFVYITDNAYTA
SQIREMEMIILRVLNFDLGRPLPLHFLRRASKSCSADAEQHTLAKYLMELTLVDYEMVHF
NPSEIAAAALCLSQKILGQGSWGATQHYYTGYTEGDLQLVMKHMAKNITKVNQNLTKHVA
VRNKYASSKLMKISTLPQLMAPLVTDLAASLS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctactcgtcgggctgcaattccccgtgaagccgataatatccttgggggcgcaatg
cggtccaaagttcaaatccatggcaaaagagctgctttgggtgaaattggcaacaaagtg
accgtgcgaggaaaaccacatgcagtcaagcagccttccaatgttgtggcaaagccgtca
aagactgtggcaactaaagttgcaaatgttaagccaaagcctgtacttgtgaaaccaaca
gtagctgaagctcacaccaaagtgccttcccctgtgccaatggatgtgtctatgaaagag
gaagagctgtgccaggcattctctgatgctttgaccagtgttgaagacattgatgcagat
gatggtggcaaccctcaattgtgcagtgactatgtgatggacatctataactacctaaag
caactggaagtccaacagtctgtacgccaatgctttctggaaggaaaagagattaatgag
cgtatgagggctatcctagttgactggcttgttcaagtgcattctaggtttcagcttctt
caggagactttgtacatgggtgttgccatcatggatcgcttcttgcaagttcagccagtc
tcccgcagcaagcttcagttggttggtgttacttccctactagttgcttccaaatatgaa
gagatgtacaccccagaggttgcagactttgtttatatcaccgataatgcctacactgca
tctcagatcagagaaatggaaatgattatccttagagtcctcaactttgaccttggacgt
ccattacctctccacttcctgagacgggcttcaaaatcttgcagtgctgatgcagagcaa
catactcttgcaaaatatctgatggagcttacactcgtagactatgaaatggtacacttc
aatccttcagaaattgcagctgctgcactctgcttatcccaaaaaattcttggccaggga
agctggggtgctactcaacactattacacaggctacacagaaggggacttgcaactggtc
atgaagcatatggccaagaacataaccaaagtcaatcagaatctaactaagcatgtggct
gtgcgaaacaagtatgcaagcagtaaactgatgaagatcagcacccttcctcagctgatg
gctcctcttgtcacagaccttgctgcaagtctctcttag

DBGET integrated database retrieval system