KEGG   Xenopus laevis (African clawed frog): 398892Help
Entry
398892            CDS       T01010                                 

Gene name
araf.L, a-raf, araf, araf-a, araf-b, araf1, pks2, rafa1
Definition
(RefSeq) A-Raf proto-oncogene, serine/threonine kinase L homeolog
  KO
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    398892 (araf.L)
   04068 FoxO signaling pathway
    398892 (araf.L)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    398892 (araf.L)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    398892 (araf.L)
   04914 Progesterone-mediated oocyte maturation
    398892 (araf.L)
  Circulatory system
   04270 Vascular smooth muscle contraction
    398892 (araf.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398892 (araf.L)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   398892 (araf.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 643 aa AA seqDB search
MKRSHTPPGALVNGALHSLSRELGKGSAVMLSAAVLELPNPGARMPTQQVSSRGASVSEY
PHTDGKSGGTVKVYLPNQQRTVVNVRPGMTVYDSLDKALKVRGLSQECCAVYRLIQGRKA
LTDWETDITPLVGEELMVEVLADVPLSMHNFVRKTHFNLAFCDFCLKFLFHGFRCQTCGY
KFHQHCSSKVPTACVDMAKLPKPLTPLSYQDFQSYYEHPTVHTPLSPQPPSPRTQHPGSA
SFSFPGEGQPLQRHRSTSTPNVHIDSTTGPVDNSIIEEALRSAAVTPVDGPPKSAQPRGS
KSPQTKSPLEATRERKTSASDEKKKVKQLGYRDSSYYWEVNSSEVIILKRIGTGSFGTVY
RGKWHGDVAVKILKVTNPTSEQIQAFKNEMQVLRKTRHVNILLFMGFMTRPQFAIITQWC
EGSSLYRHLHVIETRFDIFQLIDIARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKI
GDFGLATVKTRWSGSQQVEQPSGSILWMAPEVIRMQENSPYSFQSDVYAYGVVLYELMAG
LLPYANINNRDQIIFMVGRGYLTPDLSKVSNNCPKAMKRLLVDCMKFKREERPLFPQILS
SIELLQRALPKIERSASEPSLHRAVNSEDLNPFLISTLRLVPQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctctcacacacctcctggtgcactagtaaatggtgccttgcactctctctcc
cgtgagctgggtaagggcagtgctgttatgttgtctgccgctgtcctggagctgcccaac
cctggtgcccggatgcccacccagcaagtaagctcccggggagcctcagtcagcgaatac
ccacacacagacggcaagtctggggggacagtcaaagtttatcttcccaaccagcagagg
acagtggtgaacgtgcgccctggtatgaccgtatatgattctctggacaaggcattgaaa
gtgcgaggtctgagccaggaatgttgtgctgtgtatcgcctgatacagggccggaaagcc
ctgacagattgggagacagatatcacacccctagtgggagaggagctgatggtggaggtt
ctggcagatgttcctttatccatgcacaattttgtcagaaaaacacatttcaacctcgca
ttttgtgacttctgccttaaatttctgttccacggcttccgctgccagacctgcggctac
aagtttcaccagcactgcagcagtaaggtgcccacagcctgcgtggatatggccaagctc
ccaaagccactgacgcctctcagctatcaagacttccagtcatattatgaacatcccact
gtccacacgcccctcagtccccagccacccagcccccggacacagcaccccggatccgct
tccttttcatttcctggtgagggacagccactgcagagacatcgctccacctccaccccc
aacgttcatattgacagcaccactggccccgtggataactccatcattgaggaggcgctg
agaagtgcagcagtcacacctgtcgatggtccccctaagagtgcccagcctcgtggaagt
aaatctccccaaactaagtcaccattagaggcaacacgagagaggaagacgtctgcgtct
gatgagaagaagaaagtgaaacagcttggttaccgagactccagttattactgggaggtg
aattccagcgaggtgattatcctgaagcgcattggcacaggctcctttggcaccgtgtac
cgagggaaatggcacggagacgtggctgtgaagatcctgaaagtgaccaaccccacatcg
gagcagattcaggcctttaagaacgagatgcaggttctcaggaagactcggcatgtcaat
attctgctgttcatgggcttcatgactcgacctcagtttgccattattacccaatggtgc
gagggaagcagtttgtaccggcacctgcatgtcattgaaacgcgcttcgatattttccag
ctgatcgacattgcccggcaaacggcacaaggcatggactatctccatgccaagaatatt
atccaccgggacttgaagtcaaacaacattttcctgcatgagggactgacggtgaagatt
ggtgactttggcttggccacagtgaagacccgttggagtggatctcagcaggtggagcag
ccgagtggatctattctgtggatggctccagaggtgattaggatgcaagagaacagcccc
tacagcttccagtcagatgtatatgcctacggggtggttctgtatgaactcatggctgga
ctgttaccctatgcaaatatcaacaacagagatcagatcatttttatggtgggacgcggt
tacctcactcctgacctcagcaaggtgtccaacaattgtcccaaggcaatgaagaggctt
cttgtagactgcatgaaattcaagcgagaagagaggccccttttcccacagatcctctcc
tccattgagcttctgcagcgagctctgcctaaaatagagcgcagtgcgtccgaaccttcc
ctgcaccgggctgtcaactccgaggacctcaaccccttcctcataagcaccctccgactc
gtgcctcagtga

DBGET integrated database retrieval system