KEGG   Xenopus laevis (African clawed frog): 398964Help
Entry
398964            CDS       T01010                                 

Definition
uncharacterized protein MGC68821
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    398964
   00591 Linoleic acid metabolism
    398964
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    398964
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     398964
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP3 family
   398964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MNLIPHLSTGTWILLAALFLLILLYGIWPYGLFKKMGIPGPTPLPFIGTFLEFRKGLVQF
DTECFKKYGKTWGLYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLSGPLESAITA
AEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNIQDNVGKDEPCTMKDVIGAYS
MDVITSTSFSVNIDSLKNPSHPFVVHIKNLLKGGLLNPLIILVVVFPFLRPIFEGLNINF
FPKNFTQFFTNAVTSFREKRKKGDHTGRVDFLQLMVDSSVTEGNDSGNQHKALTDVEIMA
QSIIFIFAGYETTSTALSYLFYCLATHPDVQQRLHEEIDSFLPDKASPTYDILMQMEYLD
MVIQETLRLYPPAGRLERVSKQNIEINGVSIPKGTVTMIPAYVLQRDPDYWPEPEEFRPE
RFSKENRETHTPFTFLPFGDGPRNCIGMRFALLSMKVAIVSMLQNFSVRPCAETLIPMEY
STIGVLQPKKPIVLKFLSRTSAQE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcattcctcacctgtcaacagggacatggattctcctggctgctctttttctg
cttatattactctatggaatttggccatatggactttttaagaaaatgggaattcctgga
cctactccattgcccttcataggaacatttctggaatttagaaaaggactggtacagttt
gatacagaatgcttcaagaaatatgggaagacatggggactgtatgatgggagacaaccc
gtgcttgcaatcatggacccagctataattaaaactattcttgtaaaagagtgttacacg
aatttcactaacagacggaattttggtttgagtggtccccttgagtctgccatcactgct
gcagaggatgagcagtggaaaaggattcgaagtgtgctctcacctacattcaccagtggg
aaactaaaagagatgttccagataatgaaagattactcagatatccttgtgaaaaacatc
caggataatgtgggcaaagatgagccatgcacaatgaaggatgtgattggcgcatacagc
atggatgttatcaccagcacctcattcagtgtgaatattgactcccttaaaaatccttcc
catcctttcgttgttcatataaaaaatctgttgaaaggtggcttgctgaacccattgatc
atcttagtggtggtttttccattccttagacccatttttgagggtctaaatataaacttt
tttccaaaaaattttactcagttttttacgaatgctgtcacaagcttcagggagaagaga
aaaaaaggagatcacacgggacgtgtggatttccttcagcttatggtggattctagtgta
acagaaggaaatgattcaggcaatcagcacaaagctctgacagatgtagaaataatggct
cagtccattatatttatatttgctggatatgaaacaacaagtacagcactgtcttatctg
ttttattgtcttgccacccaccctgatgtccagcagagattgcatgaggagatagattca
tttctccctgacaaggccagtcctacttatgacattctgatgcagatggaatatcttgat
atggtcattcaggagaccctcaggttgtatccccctgcaggacggctagaaagagtctca
aagcagaatattgagattaatggtgttagcatccccaaggggacagtcacaatgatccca
gcgtatgtgctacagcgggaccctgattactggccagagcctgaagagttccgccctgaa
aggttcagtaaagaaaacagggaaacccatactccatttacctttctgccttttggggat
ggtcccaggaattgcataggaatgagatttgctctcctgagcatgaaagtggccattgtc
agcatgttacagaacttcagtgtccggccttgcgcagaaactctgattcccatggagtac
agcaccataggcgtattacagccaaagaaacccattgttttaaaatttctctcccggaca
tcagctcaagaataa

DBGET integrated database retrieval system