KEGG   Xenopus laevis (African clawed frog): 398973Help
Entry
398973            CDS       T01010                                 

Gene name
braf, B-Raf, b-raf1, braf1, rafb1
Definition
v-raf murine sarcoma viral oncogene homolog B (EC:2.7.11.1)
Orthology
K04365  
B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    398973 (braf)
   04012 ErbB signaling pathway
    398973 (braf)
   04068 FoxO signaling pathway
    398973 (braf)
   04150 mTOR signaling pathway
    398973 (braf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    398973 (braf)
  Cell communication
   04510 Focal adhesion
    398973 (braf)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    398973 (braf)
   04914 Progesterone-mediated oocyte maturation
    398973 (braf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    398973 (braf)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398973 (braf)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   398973 (braf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 790 aa AA seqDB search
MAALSGGSAEGLSLLNGAGEMSVSGGFPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPS
IYLEAYEEYTSKLDLLQQREQQLLESMGNGTDSSSLSSELTLSSVPSNLSLAPSTLSALG
TPSDPSRINPKSPQKPIVRVFLPNKQRTVVPARSGVTVRDSLKKALMMRGLIPECCAVYR
VQDGEKKPIGWDTDISWITGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGF
RCQTCCYKFHQRCSTEVPLMCVNYDRLDLLFVSKFFEHHPISQEEAPFEEFVPLVESSTP
PPPPDATGPPSLPSTSPSKSIPIPQPLRPDEDHRNQFGQRDRSSSAPNVHINTIEPVNID
DLIRDQGLQRSEGAPSVQPTRCHRKYHSRDPSPLLHTLPSEIVFDFESDPVCRGSTPGLS
ATPPASLPGSLTNVKALQKSPGQQRERKSSSSSSEDRSRMKTLGRRDSSDDWEIPDGQIT
VGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMG
YSTKPQLVIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQAAQGMDYLHAKSIIHRDLK
SNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDNNPYSFQSD
VYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLAPELSKVRSNCPKAMKRLMADCLK
KKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYTCASPKTPIQGG
GYGGFVIRAL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctaagtgggggatcagcagaggggctgtcactgcttaacggagccggcgag
atgtctgtgtccggggggtttcctgaggaggtctggaatatcaagcagatgataaagtta
acacaagagcacattgaagccctgttggacaaattcggaggcgagcacaaccccccatca
atatatctagaggcttatgaagaatacaccagcaaactggatctattgcagcagagggag
cagcagttactggagtctatgggcaatggaaccgactcctcttctttgtcttcagagctg
actctttcctctgtcccgtctaatctatcattggcaccttctactctctcagccctgggg
accccgtccgatccctctcgtatcaaccccaaatctccccagaaaccgatcgttcgagtc
tttcttcccaacaagcaacgcactgtggtaccagcaaggagtggtgtgacagtgcgagac
agccttaagaaagccctgatgatgcgagggttgatcccagaatgctgtgctgtgtacagg
gtgcaggatggggagaagaagccgattggctgggacacagatataagctggatcactgga
gaagagttacacgtggaagtcttggagaatgtgccacttacaacccataactttgtccgg
aaaaccttcttcacgttggctttctgtgacttctgccggaagctgctattccagggcttt
cgctgccagacgtgttgctacaagttccaccagcgctgcagcaccgaggtgcctctcatg
tgtgtcaactacgaccgtctagatttgctgtttgtctccaagttctttgaacatcacccg
atatctcaggaggaagctccttttgaagagtttgtcccgctggttgaatcgtcgactcct
ccgccccctccagatgccacaggccctcccagtctaccaagtacttctccttccaagtcc
atcccgataccccagccgctccgacctgacgaggaccacaggaaccagtttggccagagg
gatcgatcgtcctctgcaccgaacgtgcacataaacaccatcgaacccgtcaatatcgac
gacttgattcgagaccagggcctccagcgcagcgagggagccccctcagtccagccgacg
cgctgccatcggaaataccactcgcgggaccccagcccactccttcatactctccccagt
gaaatagtctttgattttgaatctgatcctgtttgcagaggttcaactcccggcttatcg
gcgacccctcctgcctccctccctggctccctcaccaacgtcaaggccctacagaaatcc
ccaggccagcaaagagagcgcaagtcctcctcgtcctcatcggaagaccggagtcggatg
aaaacgcttggacgtcgcgactccagtgacgactgggaaattcccgatgggcaaatcaca
gttgggcagagaataggttctggatcatttgggaccgtatataagggaaagtggcatggg
gacgtagcagtgaaaatgttgaatgtaacggctccaacgcctcagcagctacaggccttc
aaaaatgaagtaggagtcctcagaaaaacgcgacacgtgaacattctgcttttcatgggc
tactccacgaagccccaactggtaatagtgacccagtggtgcgagggctccagtctttat
caccatctgcacatcatcgagaccaaatttgagatgattaagcttatcgacattgcaaga
caggccgcacagggcatggactatttgcacgcaaagtccatcattcacagagatctgaag
agcaataatatattccttcatgaagatctgacggtaaagattggtgactttggcctggca
acagtgaagtcccgatggagtgggtctcatcaatttgagcagttatctggctccattctg
tggatggctcccgaggtcattcggatgcaagataacaacccgtatagctttcagtccgat
gtctacgcctttggcattgttctgtatgaattaatgacagggcagttgccctactcgaac
atcaacaacagagaccagatcatatttatggttgggagaggatacttagctccagaactc
agcaaagttaggagtaattgccccaaagcaatgaagcggttaatggcagactgtctgaag
aagaagagagatgaacggcccctattcccacagattctcgcctccattgaactactggcc
cggtcactgccaaaaatccaccgcagtgcgtcagagccgtccttgaaccgcgccggattc
cagacagaagacttcagcctgtacacgtgtgcttctcccaaaactcctatccagggtgga
ggttatggtgggtttgttatccgggccctgtga

DBGET integrated database retrieval system