KEGG   Xenopus laevis (African clawed frog): 398993Help
Entry
398993            CDS       T01010                                 

Gene name
adh1c, adh3
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    398993 (adh1c)
  Lipid metabolism
   00071 Fatty acid degradation
    398993 (adh1c)
  Amino acid metabolism
   00350 Tyrosine metabolism
    398993 (adh1c)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    398993 (adh1c)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    398993 (adh1c)
   00982 Drug metabolism - cytochrome P450
    398993 (adh1c)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     398993 (adh1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 376 aa AA seqDB search
MDTAGKVIKCKAAVTWEKGAPFSIEEVEVAPPKAQEVRIKIIATGICRSDDHAVEGKLSQ
VKFPIILGHEAVGIVESTGESVKNLKPGDRVIPLFAPQCEQCMCCKDPRSNICIATKLTK
SVGVMSDGTSRFTCKGKQIYHFLNTSTFTEYTVVDEMAVTKIDGGASLENTCLIGCGFST
GYGSALNTAKVHPGSTCVIFGLGGIGLAVIMGCKIAGAGRIIGVDVNPDKFDKAKELGAT
ECINPKDYDKPVAQVIVEQTGGGVDYAFECVGHIETMLAALNSSHFAYGTTVIVGVSAKE
ATITFDPMILLTGRTLKGSVFGGWKSKSSVPQLVLDSMAKKFDLEKLVTHRLPLDKINEG
FDLLHSGKSIRTILLV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatacagctggaaaggtgataaaatgcaaagcagctgttacatgggaaaaaggtgca
cccttctctatcgaggaagttgaagtggcccccccaaaagcccaggaagtccgcataaag
attattgctactggtatttgccggtcagatgatcatgcagttgaggggaaactgagtcaa
gtaaaattcccaataattcttggccatgaagctgttggcattgtggaaagcactggagaa
agtgttaagaaccttaagccaggggacagagtcatcccactttttgcacctcagtgtgaa
cagtgtatgtgttgcaaagatccaaggagcaatatctgcattgcaaccaaactgacaaaa
tcggttggagttatgtctgatggcaccagcagatttacctgcaaagggaagcaaatctac
cacttcctgaacaccagcacctttactgaatacactgtagttgatgaaatggcagtcact
aagatcgatggcggggcatctctggaaaatacctgtctcattggatgtggtttctccact
ggttatgggtctgcattaaatactgcaaaggtgcacccaggatcgacgtgtgtcatattt
ggtttaggaggtattgggcttgctgtcattatgggatgtaagatagctggggctggtcgc
atcattggagtagatgtcaatcctgacaaatttgacaaagcaaaggaactaggagctact
gaatgcataaaccccaaggattatgataaaccagtagcacaagtgattgtggagcagact
ggaggtggtgtagactatgcatttgaatgtgttggccacattgagaccatgttagctgcc
ctaaattcaagtcactttgcatatggcaccacagttatagttggagtgtctgcaaaagaa
gcaaccattacctttgatccaatgatcctgctgactgggcgcacactgaaaggttctgtc
tttggaggctggaagagtaagagttctgttccacaactggttttagattctatggcgaag
aaatttgacctggaaaagttggtgacacatcggttaccgttagataaaatcaatgaaggt
tttgatcttttacattctggcaaaagtattcgaacaatcttgttggtttaa

DBGET integrated database retrieval system