KEGG   Xenopus laevis (African clawed frog): 399000Help
Entry
399000            CDS       T01010                                 

Definition
uncharacterized protein MGC68602
Orthology
K08760  
apolipoprotein A-IV
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MLLKVAALALVLCAITGSQADVRTDKVVGAFWDYVSQLHSSTKDTVEQIQQSDISKQLNV
LIQDNMKSVNLYAGELQSQLIPFAKQIHDQMTQDSEKLREQIQQELEKLRVKISPYADEV
HKQVSKNLEELQLKLTPYAEELKSQLEKNTNTISQQLRSVVEEMDAKIRENAGNLQESLA
PYSVKLQNQIDESVDQLRKQLNPYTDEVRDKIGHQVQKLRESLSPYAEEMQESLAKQIES
MEFQMRKSVEQVDTQIKEFTEQLKNQLSPYADELKVKLQENAMDAKQTLEPYLTEISQQM
DQKIAEFKVSITPYGEALNKGLVQRVEDMKQKFGKYTVTVQDQMEYLEKDIREKFSDFIN
KGITTEN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaaggtggcagccctcgctttggttttatgtgccatcacaggctcccaagcc
gatgtcagaacagacaaagtggtcggtgctttttgggactatgtctcccagctgcacagc
agcaccaaagatacagtggagcagatccagcagtcggatatcagcaaacaactcaatgtt
ctcatacaggacaatatgaaaagtgtgaacctgtacgctggagaattacaaagccaactc
attccttttgcaaagcagatccatgaccagatgacacaagattcagagaaacttcgggag
cagatacaacaggagctggagaaactcagagtgaagatttctccttacgcagatgaagta
cataaacaagtgagcaagaatttggaggagctgcagctcaaattgactccttatgctgag
gaactgaaaagccaactagagaagaacactaacacaataagtcagcaacttaggtcagtt
gtagaagaaatggatgctaagattagggagaatgcaggaaatttgcaagagtctttggct
ccatattcagtaaaactccagaaccaaatagatgagagtgtagaccaacttagaaaacaa
cttaacccttacactgatgaagtgagagacaaaattggccatcaagtacaaaagctacgt
gagagtctgagcccttatgcagaggagatgcaggagagtttggccaagcagatagagagc
atggaattccaaatgagaaagagtgttgagcaagtggacacccagataaaagagttcaca
gagcagttaaaaaatcaattaagcccttatgcagatgagttgaaagtgaaactccaagaa
aatgctatggatgccaagcaaacacttgagccatatctcactgagataagccagcagatg
gaccagaagattgcagagtttaaagttagtattaccccctatggagaggcactcaacaaa
ggtctagtccagagggtagaagacatgaagcagaaatttgggaaatacacagtgactgtg
caagatcaaatggaatacctagaaaaagatatcagagaaaagtttagcgacttcattaat
aaaggtattactactgaaaactga

DBGET integrated database retrieval system