KEGG   Xenopus laevis (African clawed frog): 399000Help
Entry
399000            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC68602
  KO
K08760  apolipoprotein A-IV
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein DUF883 YtxH ApoLp-III Baculo_PEP_C SF-assemblin DUF4455 DUF1845 Prominin Mitofilin DUF5324 Phage_Mu_Gam Gp58 DUF885 KapB Exonuc_VII_L Phasin BshC Senescence DUF1664 DUF3584 THP2 Toxin_trans Ribosomal_S30AE Flg_hook Apo-CIII Gp-FAR-1 OmpH Fzo_mitofusin ApoC-I Allexi_40kDa Focal_AT
Motif
Other DBs
NCBI-GeneID: 399000
NCBI-ProteinID: NP_001083577
UniProt: Q6P7H6
Position
7S
AA seq 367 aa AA seqDB search
MLLKVAALALVLCAITGSQADVRTDKVVGAFWDYVSQLHSSTKDTVEQIQQSDISKQLNV
LIQDNMKSVNLYAGELQSQLIPFAKQIHDQMTQDSEKLREQIQQELEKLRVKISPYADEV
HKQVSKNLEELQLKLTPYAEELKSQLEKNTNTISQQLRSVVEEMDAKIRENAGNLQESLA
PYSVKLQNQIDESVDQLRKQLNPYTDEVRDKIGHQVQKLRESLSPYAEEMQESLAKQIES
MEFQMRKSVEQVDTQIKEFTEQLKNQLSPYADELKVKLQENAMDAKQTLEPYLTEISQQM
DQKIAEFKVSITPYGEALNKGLVQRVEDMKQKFGKYTVTVQDQMEYLEKDIREKFSDFIN
KGITTEN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaaggtggcagccctcgctttggttttatgtgccatcacaggctcccaagcc
gatgtcagaacagacaaagtggtcggtgctttttgggactatgtctcccagctgcacagc
agcaccaaagatacagtggagcagatccagcagtcggatatcagcaaacaactcaatgtt
ctcatacaggacaatatgaaaagtgtgaacctgtacgctggagaattacaaagccaactc
attccttttgcaaagcagatccatgaccagatgacacaagattcagagaaacttcgggag
cagatacaacaggagctggagaaactcagagtgaagatttctccttacgcagatgaagta
cataaacaagtgagcaagaatttggaggagctgcagctcaaattgactccttatgctgag
gaactgaaaagccaactagagaagaacactaacacaataagtcagcaacttaggtcagtt
gtagaagaaatggatgctaagattagggagaatgcaggaaatttgcaagagtctttggct
ccatattcagtaaaactccagaaccaaatagatgagagtgtagaccaacttagaaaacaa
cttaacccttacactgatgaagtgagagacaaaattggccatcaagtacaaaagctacgt
gagagtctgagcccttatgcagaggagatgcaggagagtttggccaagcagatagagagc
atggaattccaaatgagaaagagtgttgagcaagtggacacccagataaaagagttcaca
gagcagttaaaaaatcaattaagcccttatgcagatgagttgaaagtgaaactccaagaa
aatgctatggatgccaagcaaacacttgagccatatctcactgagataagccagcagatg
gaccagaagattgcagagtttaaagttagtattaccccctatggagaggcactcaacaaa
ggtctagtccagagggtagaagacatgaagcagaaatttgggaaatacacagtgactgtg
caagatcaaatggaatacctagaaaaagatatcagagaaaagtttagcgacttcattaat
aaaggtattactactgaaaactga

DBGET integrated database retrieval system