KEGG   Xenopus laevis (African clawed frog): 399022Help
Entry
399022            CDS       T01010                                 

Definition
uncharacterized protein MGC68754
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     399022
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  Syk family
   399022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 609 aa AA seqDB search
MADVAQNLPYFFGNITREESEDYLRQAGATDGLYLLRQSRSYLGGYALSVAHGRHFYHYT
IERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRQPGVQPKTGPFEDLKE
HLIREYVHQTWNLQAEALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISG
VKPNGSFLIRERDNNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYS
YKPDGLLRVLTEPCPRATGCKESFIFNRGACPAPPTHHQLSSVQSPADSMRRNRSSTAIN
EYARRPNVEVTKESMPMDTDVYRGIYEDPDEFRPKDGQIAPEQLTLLDTELGSGNFGNVK
KGMLKTLKSEKTVAVKILKNDNNDESLKDELLKEAKVMQLLNNPYIVRMLGICEGESWML
VMELAGLGPLNKFLAKNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQH
YAKISDFGLSKALGSDENYYQAKTTGKWPMKWYAPECLNYHKFSSKSDVWSFGVLMWEAY
SYGLKPYLRMKGNDVTVFIESGKRLESPQRCSPEMYNLMKLCWTYGMDERPSFAVVELKL
RSYYYDSSH
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgttgcccagaatctgccatatttttttggcaatattacccgtgaagaatct
gaagattacttgaggcaagctggtgcaactgatggcctgtatttgttgcggcaaagtcgg
agctaccttggtggttatgctctgtcagttgcacatggcagacatttttaccattatact
attgaaagagagttgaatggaacttatgccatttcaggtggcatatctcatagcagtcct
gctgaactgtgtcattatcacacattagagagcagtggacttgtctgcttgctcaagaaa
ccatgtaatcggcaacctggtgttcagccaaaaactggaccatttgaagatcttaaggaa
catctcattagagaatatgtacatcaaacgtggaatttacaggctgaagctctggaacaa
gctattatcagccaaaaacctcagctagagaagctaattgccacaactgcccatgaaaaa
atgccatggttccatggaaggatttctcgtgaagattctgagcagctccttatcagtgga
gtaaaaccaaatggatcttttctaataagagaacgagataataatggatcatatgctcta
tgtttgctacacgacagaaagatttctcattaccgtattgaccgagacaaaactggaaag
ttatcaataccagatgggaaaaaatttgatactctctggcagctggttgaacattattca
tacaaacctgatggacttctgagggtcctgacagagccatgtcccagagcaactggatgc
aaagaaagctttatatttaatcgtggagcatgtccagcacctcctacccaccatcaattg
tcatcagtgcagagtcctgcagactccatgagacggaaccgaagttctacagcaataaat
gagtatgcacgtaggccaaatgtagaagtcacaaaggagtctatgcctatggacactgat
gtctatcgaggaatatatgaagacccagatgagttccgacccaaggatggccaaattgct
ccagaacagcttactttgcttgatactgaactaggatctggcaactttggaaatgttaaa
aaaggaatgttaaagacattaaaatctgaaaaaacagtagctgttaaaattcttaaaaat
gacaacaatgatgagtcattgaaggatgagctcctcaaagaagccaaagtcatgcagcta
ctgaataatccctacattgtgagaatgcttggaatatgtgaaggggaatcatggatgctt
gtcatggagctggcgggacttgggcctctaaataagttcttggctaaaaacaagaatgtt
acagaacataatgtaacagagcttgtacatcaggtctccatgggaatgaagtatttagaa
gaaacaaattttgttcacagagacctggcagcacgaaatgttttgctggtcacgcaacat
tatgccaaaatcagtgattttgggctttccaaagcacttggatctgatgaaaattattac
caagcaaagactactgggaagtggccaatgaaatggtatgcccctgaatgtttaaactat
cataaattttcaagcaagagtgatgtttggagttttggagttctaatgtgggaggcatat
tcctatggtctaaagccatatctgcgaatgaaaggtaatgatgtgacagtttttattgag
tctggaaaacgcttggagtcccctcaacgttgttcaccagaaatgtacaatttaatgaaa
ttatgttggacatatggtatggatgaacgaccttcttttgctgtagttgaactaaaactt
cgcagttattattatgacagttctcactga

DBGET integrated database retrieval system