KEGG   Xenopus laevis (African clawed frog): 399031Help
Entry
399031            CDS       T01010                                 

Gene name
MGC68684
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    399031 (MGC68684)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    399031 (MGC68684)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     399031 (MGC68684)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MAQYHGRLLKNSDVEFADTGYGKNAVKVLQIKRNGKQHFIKEIEASVQLTLKSKKDYLEG
DNADIIPTDTIKNTIYALTKLKGIKTIEEFSMELARHFLTSFNHVTDVKVFIEEAPWRRI
EKNGMSHVHAFIYSPEGVHFCELQQQKGGQPAIYSGIKELRILKTTQSGFEGFIKDRFTT
LPEVKDRFFSTIVNCKWKYGTSKVADYDAVWKTIVETILDTFAGPYDKGEYSPSVQKTLY
DIQVLSLQKIPEIEEIEIILPNKHYFTIDMSKMGLTNQDEVLMPADIPYGNIAGTLRRKP
SSKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtaccatggacgtctattaaagaattcagatgttgagtttgctgacacaggc
tatggcaaaaatgcagttaaagtccttcaaatcaagaggaatggaaagcaacattttatt
aaagaaattgaagcctctgttcaacttaccttaaagtccaagaaggattatttggaggga
gataatgctgacattattcctacagacacaattaaaaataccatctatgccttgactaaa
ctcaaagggattaaaacaatagaagaattttccatggagctagcaagacattttctcacc
tcctttaaccatgttactgacgtgaaagtttttatcgaggaagctccatggaggcgtatt
gaaaagaatggaatgagccatgtccatgcatttatttattcacctgaaggggttcacttc
tgtgagctacaacaacaaaaaggaggtcaaccggctatttactctggtatcaaagaacta
agaattctgaagactacccaatctggattcgaaggttttataaaagaccgttttactaca
cttcctgaagtgaaagatcgcttcttttcaaccattgttaactgcaaatggaaatatggc
accagtaaagtagccgattatgatgctgtttggaaaaccatagtggaaaccatacttgat
acatttgctggtccttatgacaaaggagaatattctccatctgtgcagaagactctttat
gacatccaggtgctgagcctacagaagattcctgagattgaagaaattgaaattatcctt
cctaacaaacactattttaccattgacatgagcaaaatgggcctgaccaaccaggatgag
gtcttgatgcctgctgacattccttatggaaatattgctggtactttaagacggaaacca
tcttcaaaactgtaa

DBGET integrated database retrieval system