KEGG   Xenopus laevis (African clawed frog): 399031Help
Entry
399031            CDS       T01010                                 

Gene name
MGC68684
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xla00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MAQYHGRLLKNSDVEFADTGYGKNAVKVLQIKRNGKQHFIKEIEASVQLTLKSKKDYLEG
DNADIIPTDTIKNTIYALTKLKGIKTIEEFSMELARHFLTSFNHVTDVKVFIEEAPWRRI
EKNGMSHVHAFIYSPEGVHFCELQQQKGGQPAIYSGIKELRILKTTQSGFEGFIKDRFTT
LPEVKDRFFSTIVNCKWKYGTSKVADYDAVWKTIVETILDTFAGPYDKGEYSPSVQKTLY
DIQVLSLQKIPEIEEIEIILPNKHYFTIDMSKMGLTNQDEVLMPADIPYGNIAGTLRRKP
SSKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtaccatggacgtctattaaagaattcagatgttgagtttgctgacacaggc
tatggcaaaaatgcagttaaagtccttcaaatcaagaggaatggaaagcaacattttatt
aaagaaattgaagcctctgttcaacttaccttaaagtccaagaaggattatttggaggga
gataatgctgacattattcctacagacacaattaaaaataccatctatgccttgactaaa
ctcaaagggattaaaacaatagaagaattttccatggagctagcaagacattttctcacc
tcctttaaccatgttactgacgtgaaagtttttatcgaggaagctccatggaggcgtatt
gaaaagaatggaatgagccatgtccatgcatttatttattcacctgaaggggttcacttc
tgtgagctacaacaacaaaaaggaggtcaaccggctatttactctggtatcaaagaacta
agaattctgaagactacccaatctggattcgaaggttttataaaagaccgttttactaca
cttcctgaagtgaaagatcgcttcttttcaaccattgttaactgcaaatggaaatatggc
accagtaaagtagccgattatgatgctgtttggaaaaccatagtggaaaccatacttgat
acatttgctggtccttatgacaaaggagaatattctccatctgtgcagaagactctttat
gacatccaggtgctgagcctacagaagattcctgagattgaagaaattgaaattatcctt
cctaacaaacactattttaccattgacatgagcaaaatgggcctgaccaaccaggatgag
gtcttgatgcctgctgacattccttatggaaatattgctggtactttaagacggaaacca
tcttcaaaactgtaa

DBGET integrated database retrieval system