KEGG   Xenopus laevis (African clawed frog): 399056Help
Entry
399056            CDS       T01010                                 

Gene name
araf-b, a-raf, araf, araf1, pks2, rafa1
Definition
v-raf murine sarcoma 3611 viral oncogene homolog
Orthology
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    399056 (araf-b)
   04068 FoxO signaling pathway
    399056 (araf-b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    399056 (araf-b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399056 (araf-b)
   04914 Progesterone-mediated oocyte maturation
    399056 (araf-b)
  Circulatory system
   04270 Vascular smooth muscle contraction
    399056 (araf-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399056 (araf-b)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   399056 (araf-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 595 aa AA seqDB search
MMPTQQESSRGASVSEYPYAEGKSGGTVKVYLPHQQWTVVNVRPGMTVYDSLDKALKMRG
LSQECCAVYRLIQGRKALTDWETDITPLVGEELMVEVLADVPLSMHNFVRKTHFNLAFCD
FCLKFLFHGFRCQTCGYKFHQHCSSKVPTACVDMAKLPKPLTPLSYQDFQSYYDHPPVHT
PLSPQPPSPRTQHPGSASFSFPVEGQPLQRHRSTSTPNVHIDSTTGPVDNSIIEEALRSA
ALTPVDGPPKSAQPLGSKSPQTKSASEPARERKASASDEKKKVKQLGYRDSSYYWEVNSS
EVIILKRIGTGSFGTVYRGKWHGDVAVKILKVTNPTSEQIQAFKNEMQVLRKTRHVNILL
FMGFMTRPQFAIITQWCEGSSLYRHLHVIETRFDIFQLIDIARQTAQGMDYLHAKNIIHR
DLKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPSGSILWMAPEVIRMQESSPYSF
QSDVYAYGVVLYELMAAVLPYANINNRDQIIFMVGRGYLTPDLSKVSNNCPKAMKRLIVD
CQKFKREERPLFPQILSSIELLQRALPKIERSASEPSLHRVVNSEDLNPFRLVPQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccactcagcaagaaagctcccggggagcctcggtcagtgaatacccatatgca
gagggcaagtctggggggacagtcaaagtttatcttccacaccagcagtggacagtggtg
aacgtgcggcctggtatgacagtttatgattctctggacaaggcactgaaaatgcgaggt
ctgagccaggaatgctgtgctgtgtatcgccttatacagggccggaaagccctgacagat
tgggagacagatatcacacccctagtgggagaggagctgatggtggaggttctggcagac
gttcctttatctatgcacaattttgtcagaaaaacacatttcaacctcgcgttttgtgac
ttctgccttaaatttctgttccatggctttcgctgtcagacatgtggctacaagtttcac
cagcactgcagcagtaaggtgcccacagcctgcgtggatatggccaaactcccaaagcct
ctgacgccactgagttatcaagacttccagtcatattatgatcatccccccgtccacaca
cccctcagtccccagccgcccagcccccggacacagcaccctggatccgcatccttttca
tttcctgtcgagggacagccactgcagcggcatcgctccacctccacccccaacgttcat
attgacagcaccactggccctgtggataactccatcatcgaggaggcgctgagaagtgct
gcattaacacctgttgatggcccccccaagagtgcccagcctcttggcagtaaatcgcct
caaacaaagtcggcctctgagccagcgcgagagaggaaggcgtctgcgtctgatgaaaag
aagaaagtgaaacagcttggttaccgcgactccagttattactgggaggtgaattccagt
gaggtgattatcctaaagcgcattggcacaggctcgtttggcactgtgtaccgaggtaaa
tggcatggagatgtggctgtgaagatcctaaaagtgaccaatcccacgtcagagcagatt
caggcttttaagaacgaaatgcaggttctcagaaagacccggcatgtcaatattctgctg
tttatgggcttcatgactcgtcctcagtttgccatcattacccaatggtgcgagggaagc
agtttgtaccggcacttgcatgtcattgagacgcgctttgatattttccagctgatcgac
attgcccgacaaacagcacaaggcatggactatctccatgccaagaatattatccaccgg
gacctgaagtcaaacaacatcttcctgcatgagggcctgacagtgaagatcggtgacttt
ggcttggccacagtaaagagccggtggagtggatctcagcaggtggagcagcctagcgga
tctattctctggatggctccagaggtgatcaggatgcaggagagcagtccctacagcttc
cagtcagatgtatatgcctacggggtggttctgtatgaactcatggctgcagtgttaccc
tatgctaatatcaacaacagagatcagatcatatttatggtaggacgtggttacctcact
cctgacctcagcaaggtgtccaacaactgtcccaaggcaatgaagaggcttattgtagat
tgccagaaattcaagagagaggagaggccccttttcccacagatcctctcctccattgag
ctactgcagcgagcgctgcctaaaattgagcgcagtgcgtccgaaccttccctgcatcgc
gtcgttaactcagaggacctcaaccccttccgacttgtgcctcagtga

DBGET integrated database retrieval system