KEGG   Xenopus laevis (African clawed frog): 399056Help
Entry
399056            CDS       T01010                                 

Gene name
araf.S, a-raf, araf, araf-a, araf-b, araf1, pks2, rafa1
Definition
(RefSeq) A-Raf proto-oncogene, serine/threonine kinase S homeolog
  KO
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    399056 (araf.S)
   04068 FoxO signaling pathway
    399056 (araf.S)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    399056 (araf.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399056 (araf.S)
   04914 Progesterone-mediated oocyte maturation
    399056 (araf.S)
  Circulatory system
   04270 Vascular smooth muscle contraction
    399056 (araf.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399056 (araf.S)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   399056 (araf.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
8S
AA seq 595 aa AA seqDB search
MMPTQQESSRGASVSEYPYAEGKSGGTVKVYLPHQQWTVVNVRPGMTVYDSLDKALKMRG
LSQECCAVYRLIQGRKALTDWETDITPLVGEELMVEVLADVPLSMHNFVRKTHFNLAFCD
FCLKFLFHGFRCQTCGYKFHQHCSSKVPTACVDMAKLPKPLTPLSYQDFQSYYDHPPVHT
PLSPQPPSPRTQHPGSASFSFPVEGQPLQRHRSTSTPNVHIDSTTGPVDNSIIEEALRSA
ALTPVDGPPKSAQPLGSKSPQTKSASEPARERKASASDEKKKVKQLGYRDSSYYWEVNSS
EVIILKRIGTGSFGTVYRGKWHGDVAVKILKVTNPTSEQIQAFKNEMQVLRKTRHVNILL
FMGFMTRPQFAIITQWCEGSSLYRHLHVIETRFDIFQLIDIARQTAQGMDYLHAKNIIHR
DLKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPSGSILWMAPEVIRMQESSPYSF
QSDVYAYGVVLYELMAAVLPYANINNRDQIIFMVGRGYLTPDLSKVSNNCPKAMKRLIVD
CQKFKREERPLFPQILSSIELLQRALPKIERSASEPSLHRVVNSEDLNPFRLVPQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccactcagcaagaaagctcccggggagcctcggtcagtgaatacccatatgca
gagggcaagtctggggggacagtcaaagtttatcttccacaccagcagtggacagtggtg
aacgtgcggcctggtatgacagtttatgattctctggacaaggcactgaaaatgcgaggt
ctgagccaggaatgctgtgctgtgtatcgccttatacagggccggaaagccctgacagat
tgggagacagatatcacacccctagtgggagaggagctgatggtggaggttctggcagac
gttcctttatctatgcacaattttgtcagaaaaacacatttcaacctcgcgttttgtgac
ttctgccttaaatttctgttccatggctttcgctgtcagacatgtggctacaagtttcac
cagcactgcagcagtaaggtgcccacagcctgcgtggatatggccaaactcccaaagcct
ctgacgccactgagttatcaagacttccagtcatattatgatcatccccccgtccacaca
cccctcagtccccagccgcccagcccccggacacagcaccctggatccgcatccttttca
tttcctgtcgagggacagccactgcagcggcatcgctccacctccacccccaacgttcat
attgacagcaccactggccctgtggataactccatcatcgaggaggcgctgagaagtgct
gcattaacacctgttgatggcccccccaagagtgcccagcctcttggcagtaaatcgcct
caaacaaagtcggcctctgagccagcgcgagagaggaaggcgtctgcgtctgatgaaaag
aagaaagtgaaacagcttggttaccgcgactccagttattactgggaggtgaattccagt
gaggtgattatcctaaagcgcattggcacaggctcgtttggcactgtgtaccgaggtaaa
tggcatggagatgtggctgtgaagatcctaaaagtgaccaatcccacgtcagagcagatt
caggcttttaagaacgaaatgcaggttctcagaaagacccggcatgtcaatattctgctg
tttatgggcttcatgactcgtcctcagtttgccatcattacccaatggtgcgagggaagc
agtttgtaccggcacttgcatgtcattgagacgcgctttgatattttccagctgatcgac
attgcccgacaaacagcacaaggcatggactatctccatgccaagaatattatccaccgg
gacctgaagtcaaacaacatcttcctgcatgagggcctgacagtgaagatcggtgacttt
ggcttggccacagtaaagagccggtggagtggatctcagcaggtggagcagcctagcgga
tctattctctggatggctccagaggtgatcaggatgcaggagagcagtccctacagcttc
cagtcagatgtatatgcctacggggtggttctgtatgaactcatggctgcagtgttaccc
tatgctaatatcaacaacagagatcagatcatatttatggtaggacgtggttacctcact
cctgacctcagcaaggtgtccaacaactgtcccaaggcaatgaagaggcttattgtagat
tgccagaaattcaagagagaggagaggccccttttcccacagatcctctcctccattgag
ctactgcagcgagcgctgcctaaaattgagcgcagtgcgtccgaaccttccctgcatcgc
gtcgttaactcagaggacctcaaccccttccgacttgtgcctcagtga

DBGET integrated database retrieval system