KEGG   Xenopus laevis (African clawed frog): 399056Help
Entry
399056            CDS       T01010                                 

Gene name
araf-b, a-raf, araf, araf1, pks2, rafa1
Definition
v-raf murine sarcoma 3611 viral oncogene homolog
Orthology
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xla04012]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xla04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 595 aa AA seqDB search
MMPTQQESSRGASVSEYPYAEGKSGGTVKVYLPHQQWTVVNVRPGMTVYDSLDKALKMRG
LSQECCAVYRLIQGRKALTDWETDITPLVGEELMVEVLADVPLSMHNFVRKTHFNLAFCD
FCLKFLFHGFRCQTCGYKFHQHCSSKVPTACVDMAKLPKPLTPLSYQDFQSYYDHPPVHT
PLSPQPPSPRTQHPGSASFSFPVEGQPLQRHRSTSTPNVHIDSTTGPVDNSIIEEALRSA
ALTPVDGPPKSAQPLGSKSPQTKSASEPARERKASASDEKKKVKQLGYRDSSYYWEVNSS
EVIILKRIGTGSFGTVYRGKWHGDVAVKILKVTNPTSEQIQAFKNEMQVLRKTRHVNILL
FMGFMTRPQFAIITQWCEGSSLYRHLHVIETRFDIFQLIDIARQTAQGMDYLHAKNIIHR
DLKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPSGSILWMAPEVIRMQESSPYSF
QSDVYAYGVVLYELMAAVLPYANINNRDQIIFMVGRGYLTPDLSKVSNNCPKAMKRLIVD
CQKFKREERPLFPQILSSIELLQRALPKIERSASEPSLHRVVNSEDLNPFRLVPQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccactcagcaagaaagctcccggggagcctcggtcagtgaatacccatatgca
gagggcaagtctggggggacagtcaaagtttatcttccacaccagcagtggacagtggtg
aacgtgcggcctggtatgacagtttatgattctctggacaaggcactgaaaatgcgaggt
ctgagccaggaatgctgtgctgtgtatcgccttatacagggccggaaagccctgacagat
tgggagacagatatcacacccctagtgggagaggagctgatggtggaggttctggcagac
gttcctttatctatgcacaattttgtcagaaaaacacatttcaacctcgcgttttgtgac
ttctgccttaaatttctgttccatggctttcgctgtcagacatgtggctacaagtttcac
cagcactgcagcagtaaggtgcccacagcctgcgtggatatggccaaactcccaaagcct
ctgacgccactgagttatcaagacttccagtcatattatgatcatccccccgtccacaca
cccctcagtccccagccgcccagcccccggacacagcaccctggatccgcatccttttca
tttcctgtcgagggacagccactgcagcggcatcgctccacctccacccccaacgttcat
attgacagcaccactggccctgtggataactccatcatcgaggaggcgctgagaagtgct
gcattaacacctgttgatggcccccccaagagtgcccagcctcttggcagtaaatcgcct
caaacaaagtcggcctctgagccagcgcgagagaggaaggcgtctgcgtctgatgaaaag
aagaaagtgaaacagcttggttaccgcgactccagttattactgggaggtgaattccagt
gaggtgattatcctaaagcgcattggcacaggctcgtttggcactgtgtaccgaggtaaa
tggcatggagatgtggctgtgaagatcctaaaagtgaccaatcccacgtcagagcagatt
caggcttttaagaacgaaatgcaggttctcagaaagacccggcatgtcaatattctgctg
tttatgggcttcatgactcgtcctcagtttgccatcattacccaatggtgcgagggaagc
agtttgtaccggcacttgcatgtcattgagacgcgctttgatattttccagctgatcgac
attgcccgacaaacagcacaaggcatggactatctccatgccaagaatattatccaccgg
gacctgaagtcaaacaacatcttcctgcatgagggcctgacagtgaagatcggtgacttt
ggcttggccacagtaaagagccggtggagtggatctcagcaggtggagcagcctagcgga
tctattctctggatggctccagaggtgatcaggatgcaggagagcagtccctacagcttc
cagtcagatgtatatgcctacggggtggttctgtatgaactcatggctgcagtgttaccc
tatgctaatatcaacaacagagatcagatcatatttatggtaggacgtggttacctcact
cctgacctcagcaaggtgtccaacaactgtcccaaggcaatgaagaggcttattgtagat
tgccagaaattcaagagagaggagaggccccttttcccacagatcctctcctccattgag
ctactgcagcgagcgctgcctaaaattgagcgcagtgcgtccgaaccttccctgcatcgc
gtcgttaactcagaggacctcaaccccttccgacttgtgcctcagtga

DBGET integrated database retrieval system