KEGG   Xenopus laevis (African clawed frog): 399076Help
Entry
399076            CDS       T01010                                 

Gene name
slc9a3r2, nherf-2, nherf2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 348 aa AA seqDB search
MAQERLRPRLCHITRGDQGYGFHLHGEKGKSGQYIRKVEPGSSAEAAGLKAGDRVLEVNG
ENVEKETHHQVVQRIKAIENETRLLVVDREADEYLKKSPPSSRPESEPNSSAPSTPTPGS
NNNGEVWKTKEDTSHEDQLHNNHSTENGKQDMNGQVKERCPRLCYLKKGSSGYGFNLHSE
KSRPGQFIRSVDPGSPAAKAGLRPQDRLVEVNGQNIENIKHSEVVANIKSKDNETKLLVI
DPDTDEYFKKLGITPTEDHAKGTIPLTNGVTPTQLNGDSSTSSSHSDLQSPDKDSQAGDL
IRKDPFEESGLRLCPTAAEAKEKARAKRANKRAPQMDWSKKHEIFSNF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagagcggctccgaccccgactctgccacatcacgaggggagatcagggctac
ggtttccacctgcacggagagaagggcaagagcggccagtacatccgcaaggtggaaccc
ggctcctccgctgaggctgcgggacttaaagctggagaccgagtgctggaagtcaacggg
gagaacgtggagaaggagacgcatcaccaggtggttcagcgcattaaggcaatagaaaac
gaaacgcggttgctggtggtggacagagaagctgacgaatacctgaaaaaatccccaccc
agttcgcgtccggaatccgaacccaactccagtgccccctcaactccgactccggggagc
aacaacaacggcgaagtatggaaaacgaaggaggacacaagccatgaagatcagctgcac
aataaccacagcacggagaatgggaagcaggatatgaatgggcaagtgaaggagaggtgc
cctcgtttgtgttatctgaaaaaaggctccagtggttacggctttaatctgcacagtgaa
aaatcccggccgggccagtttatcaggtctgtggacccaggatcaccggcagccaaggct
ggtttgagaccgcaggatcggctggtagaggtgaatggacagaatattgaaaacataaag
cattcagaagtggtggccaacatcaaatctaaggacaatgagaccaagctacttgttata
gacccggacacagacgaatacttcaagaagctcgggatcacccccactgaggatcatgcc
aaaggcaccatccccttgaccaacggggtgactcctacacagctgaatggagactcctca
acttcttcatctcacagtgacctgcaaagcccagataaggactcacaggcaggggacctg
atcaggaaggatccatttgaggaaagtggcttgcggctctgtcctacagcagctgaagca
aaggagaaagcgagggccaaacgagccaacaagcgtgctccacagatggactggagcaag
aagcatgagatattcagcaacttctaa

DBGET integrated database retrieval system