KEGG   Xenopus laevis (African clawed frog): 399090Help
Entry
399090            CDS       T01010                                 

Gene name
pak2.S, pak2, pak65, pakgamma
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 2 S homeolog
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399090 (pak2.S)
   04012 ErbB signaling pathway
    399090 (pak2.S)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    399090 (pak2.S)
  Cellular community - eukaryotes
   04510 Focal adhesion
    399090 (pak2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399090 (pak2.S)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   399090 (pak2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 517 aa AA seqDB search
MSDNGELEDKPPAPPARISSTGTKDTLTSNHSHKPLPLIPEKPRNKIISMFSGTEKGSKK
KERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLK
FYDSKHTDKQKYLSFSAPDKDGLPSGLCPAPNAKGSEPSTAATDDDDFDDDKAPPPAIAP
RPEHTKSMYTRSVIDPIPPPPGDSDSAAKTGDRQKKKTKMSDEEIMEKLRTIVSIGDPKK
KYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIV
NFLDSFLVNEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHR
DIKSDNVLLGMDGSVKLTDFSFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVEK
RGSARELLQHPFLKIAKPLSSLTPLILAAKEAMKGNR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggggagcttgaggataagccaccagctcctccagctcggattagcagc
acagggacaaaagatactctgaccagcaaccacagtcataagcctttacccttgatccct
gaaaaacccaggaataaaatcatttcaatgttttctggcacagaaaaaggaagcaaaaaa
aaagaaaggccagagatttcaccgccatcggattttgagcacacaattcatgtgggcttc
gatgctgtcactggggaattcactggaatgccagagcaatgggcacgattactgcagacc
tcaaacatcactaaactcgaacagaagaagaatccacaagctgtcctagacgttttaaag
ttttatgactccaaacacactgacaagcagaaatatctgagcttctcggcaccagataaa
gatgggctcccctctggtctgtgccctgcacctaatgcaaaaggctctgaaccttcaaca
gcagcaacagatgatgacgattttgatgatgataaggctcctcctcctgctattgctcca
agacctgaacacacaaaatcaatgtatacacgttctgtaattgacccaatacctccaccc
cctggagattcagacagtgctgcaaagactggagacagacagaaaaagaaaaccaagatg
agcgatgaagagattatggaaaaacttagaactatagtaagcataggagatcccaagaaa
aagtatactagatatgaaaaaattggacaaggggcctctggaactgtatttactgctatt
gatgtagctacaggacaagaggttgcaatcaagcagataaatcttcagaagcagcccaag
aaagaactgataatcaatgagattctggtgatgaaagaattgaagaaccccaatatagta
aatttcttggacagtttcttagtgaatgaggaactgtatgttgtaatggaatatttggct
ggagggtccctaacagacgtggtcacagaaacctgcatggatgaggcacagatagcagct
gtctgcagagagtgtctgcaagcgttggaattcctgcatgcgaaccaggtcattcacaga
gacataaagagtgataatgtacttcttggaatggatggttctgtcaaactgaccgacttt
agcttctgtgcacaaattaccccagaacaaagcaagagaagtaccatggtgggaacacca
tactggatggcaccagaggtggttacacgaaaagcatatggccctaaggtggacatctgg
tcacttggaattatggctattgaaatggtggaaggggaaccgccttacctcaacgaaaat
cctttaagagcattgtatttgattgctactaatggcactccagaacttcagaaacctgaa
aaactttcaccgatattccgggatttcttaaaccgctcacttgagatggatgtagaaaag
agaggttctgctagagagctcctgcagcacccgttcctgaaaattgcaaaaccactgtcc
agcctaacaccgctaatcctggctgccaaagaagcaatgaagggaaaccgctaa

DBGET integrated database retrieval system