KEGG   Xenopus laevis (African clawed frog): 399090Help
Entry
399090            CDS       T01010                                 

Gene name
pak2, pak65, pakgamma
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399090 (pak2)
   04012 ErbB signaling pathway
    399090 (pak2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    399090 (pak2)
  Cell communication
   04510 Focal adhesion
    399090 (pak2)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399090 (pak2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   399090 (pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 517 aa AA seqDB search
MSDNGELEDKPPAPPARISSTGTKDTLTSNHSHKPLPLIPEKPRNKIISMFSGTEKGSKK
KERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLK
FYDSKHTDKQKYLSFSAPDKDGLPSGLCPAPNAKGSEPSTAATDDDDFDDDKAPPPAIAP
RPEHTKSMYTRSVIDPIPPPPGDSDSAAKTGDRQKKKTKMSDEEIMEKLRTIVSIGDPKK
KYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIV
NFLDSFLVNEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHR
DIKSDNVLLGMDGSVKLTDFSFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVEK
RGSARELLQHPFLKIAKPLSSLTPLILAAKEAMKGNR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggggagcttgaggataagccaccagctcctccagctcggattagcagc
acagggacaaaagatactctgaccagcaaccacagtcataagcctttacccttgatccct
gaaaaacccaggaataaaatcatttcaatgttttctggcacagaaaaaggaagcaaaaaa
aaagaaaggccagagatttcaccgccatcggattttgagcacacaattcatgtgggcttc
gatgctgtcactggggaattcactggaatgccagagcaatgggcacgattactgcagacc
tcaaacatcactaaactcgaacagaagaagaatccacaagctgtcctagacgttttaaag
ttttatgactccaaacacactgacaagcagaaatatctgagcttctcggcaccagataaa
gatgggctcccctctggtctgtgccctgcacctaatgcaaaaggctctgaaccttcaaca
gcagcaacagatgatgacgattttgatgatgataaggctcctcctcctgctattgctcca
agacctgaacacacaaaatcaatgtatacacgttctgtaattgacccaatacctccaccc
cctggagattcagacagtgctgcaaagactggagacagacagaaaaagaaaaccaagatg
agcgatgaagagattatggaaaaacttagaactatagtaagcataggagatcccaagaaa
aagtatactagatatgaaaaaattggacaaggggcctctggaactgtatttactgctatt
gatgtagctacaggacaagaggttgcaatcaagcagataaatcttcagaagcagcccaag
aaagaactgataatcaatgagattctggtgatgaaagaattgaagaaccccaatatagta
aatttcttggacagtttcttagtgaatgaggaactgtatgttgtaatggaatatttggct
ggagggtccctaacagacgtggtcacagaaacctgcatggatgaggcacagatagcagct
gtctgcagagagtgtctgcaagcgttggaattcctgcatgcgaaccaggtcattcacaga
gacataaagagtgataatgtacttcttggaatggatggttctgtcaaactgaccgacttt
agcttctgtgcacaaattaccccagaacaaagcaagagaagtaccatggtgggaacacca
tactggatggcaccagaggtggttacacgaaaagcatatggccctaaggtggacatctgg
tcacttggaattatggctattgaaatggtggaaggggaaccgccttacctcaacgaaaat
cctttaagagcattgtatttgattgctactaatggcactccagaacttcagaaacctgaa
aaactttcaccgatattccgggatttcttaaaccgctcacttgagatggatgtagaaaag
agaggttctgctagagagctcctgcagcacccgttcctgaaaattgcaaaaccactgtcc
agcctaacaccgctaatcctggctgccaaagaagcaatgaagggaaaccgctaa

DBGET integrated database retrieval system