KEGG   Xenopus laevis (African clawed frog): 399129Help
Entry
399129            CDS       T01010                                 

Gene name
rad21
Definition
14S cohesin RAD21 subunit
Orthology
K06670  
cohesin complex subunit SCC1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    399129 (rad21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIICPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQDNDFGDFGMDDREMMREGSAFEDD
MLTTNASNLKLEPEQSTSQLNEKSNHLEYDDQYKDDNFGEGNEGGILDDKLLSNDAGGIF
DDPPAMPEEGVAMPEQPVHDDLDDDDNVSMGAPDSPDSVDPVEPLPTMTDQTTLVPNEEE
AFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMM
WKETGGVEKLFSLPAQPLWNTRLLKLFTRCLTPLVLDDLRKRRKGGEADNLDEFLKEFEN
PEVPREELRPQDVIDQPILEEASHLQESLMEGSRTHLDDTIMPPPPPKQGVKRDSLQMEP
EPMPMMQEAEPQIEMPPPPLPPPLELPPEEPQSISDLIPELNLLPEKEKEKDEEEEEEEE
DTTGTEQDQEERRWNKRTQQMLHGLQRVLAKTGAESISLLDLCRNTNRKQAAAKFYSFLV
LKKQQAIELTQREPYSDIVATPGPRFHTV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttctatgcacatttcgtcctcagtaagcgtgggccgctggccaaaatctggctagcg
gcccactgggataagaagcttaccaaagcccatgtgtttgagtgcaacctggaaagcagt
gtggagagtattatttgccctaaggtgaaaatggctctgcggacctctgggcatcttctc
ttgggagttgtaagaatctaccaccggaaagcaaagtatctcctggctgactgtaatgaa
gctttcatcaaaataaagatggctttccgccctggtgttgtggatttacctgaggaaaac
agagaggctgcctacaatgctatcactctgcccgaggagttccatgactttgaccagcct
ctaccagatctagatgacattgatgtggctcagcagtttagcctgaaccaaagtcgagtt
gaggagattacaatgagggaagaggttagcaacattaatatcctgcaagataatgatttt
ggtgactttggcatggacgacagagagatgatgcgggaaggcagcgcttttgaagatgac
atgttgacaaccaatgcttccaatctgaagctggagcccgagcagagcaccagtcagcta
aatgagaagagtaaccacctggaatatgacgaccaatacaaagatgacaactttggagag
ggaaatgaaggcggcatactagatgacaaacttctaagcaatgatgcaggggggatattt
gacgacccacctgctatgcctgaagaaggtgttgcaatgcccgagcagcctgtccatgat
gatctggatgatgatgacaatgtttcaatgggggcaccagatagtccagattctgtggat
ccagtggaaccccttccaaccatgactgatcaaacaaccctggttcccaatgaagaggaa
gcatttgccctggaacccattgatatcactgtcaaggagaccaaggctaaaaggaagagg
aaactgattgtggacagtgttaaagagttggatagcaagactattcgtgcccaactcagc
gattactcggacattgttactacactggatttggctcctcctacaaagaagctgatgatg
tggaaggagactggtggtgtggagaaattgttttcattgcctgcccagccattatggaac
acccggttgcttaagctgtttacacgctgtctcacaccacttgttctcgatgatctccga
aagcgaaggaaaggaggtgaagcagataatcttgatgaattcctcaaggagtttgagaat
ccagaagtcccaagagaagaactgcgtcctcaagatgttattgatcaacccatcttggaa
gaagccagtcatctgcaagagtcattgatggagggtagtcgaactcacttggatgatact
ataatgccaccacctccacctaaacaaggagttaaacgtgactccttgcaaatggaacca
gagccgatgcccatgatgcaggaagcagaaccacagattgaaatgccaccacctccactt
ccccctccattggaacttccaccagaagagcctcagagcatcagtgacttaatccctgag
ttaaatctcctgccagaaaaggagaaggaaaaggatgaggaggaggaagaagaggaggaa
gataccacggggactgagcaggatcaagaggagaggcggtggaataagagaacacagcag
atgctccatggtcttcagcgagttcttgctaaaacaggagccgaatccatcagtttgctt
gacctgtgcagaaacacaaaccgaaagcaagcggccgccaaattctacagtttcctggtc
cttaaaaagcagcaagctatagaattgacccagcgggagccttacagcgacatcgttgct
accccaggaccgaggttccacaccgtttga

DBGET integrated database retrieval system