KEGG   Xenopus laevis (African clawed frog): 399129Help
Entry
399129            CDS       T01010                                 

Gene name
rad21.L, hr21, mcd1, nxp-1, nxp1, rad21, scc1, xrad21
Definition
(RefSeq) RAD21 cohesin complex component L homeolog
  KO
K06670  
cohesin complex subunit SCC1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    399129 (rad21.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Cohesin complex
    399129 (rad21.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
6L
AA seq 629 aa AA seqDB search
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIICPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQDNDFGDFGMDDREMMREGSAFEDD
MLTTNASNLKLEPEQSTSQLNEKSNHLEYDDQYKDDNFGEGNEGGILDDKLLSNDAGGIF
DDPPAMPEEGVAMPEQPVHDDLDDDDNVSMGAPDSPDSVDPVEPLPTMTDQTTLVPNEEE
AFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMM
WKETGGVEKLFSLPAQPLWNTRLLKLFTRCLTPLVLDDLRKRRKGGEADNLDEFLKEFEN
PEVPREELRPQDVIDQPILEEASHLQESLMEGSRTHLDDTIMPPPPPKQGVKRDSLQMEP
EPMPMMQEAEPQIEMPPPPLPPPLELPPEEPQSISDLIPELNLLPEKEKEKDEEEEEEEE
DTTGTEQDQEERRWNKRTQQMLHGLQRVLAKTGAESISLLDLCRNTNRKQAAAKFYSFLV
LKKQQAIELTQREPYSDIVATPGPRFHTV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttctatgcacatttcgtcctcagtaagcgtgggccgctggccaaaatctggctagcg
gcccactgggataagaagcttaccaaagcccatgtgtttgagtgcaacctggaaagcagt
gtggagagtattatttgccctaaggtgaaaatggctctgcggacctctgggcatcttctc
ttgggagttgtaagaatctaccaccggaaagcaaagtatctcctggctgactgtaatgaa
gctttcatcaaaataaagatggctttccgccctggtgttgtggatttacctgaggaaaac
agagaggctgcctacaatgctatcactctgcccgaggagttccatgactttgaccagcct
ctaccagatctagatgacattgatgtggctcagcagtttagcctgaaccaaagtcgagtt
gaggagattacaatgagggaagaggttagcaacattaatatcctgcaagataatgatttt
ggtgactttggcatggacgacagagagatgatgcgggaaggcagcgcttttgaagatgac
atgttgacaaccaatgcttccaatctgaagctggagcccgagcagagcaccagtcagcta
aatgagaagagtaaccacctggaatatgacgaccaatacaaagatgacaactttggagag
ggaaatgaaggcggcatactagatgacaaacttctaagcaatgatgcaggggggatattt
gacgacccacctgctatgcctgaagaaggtgttgcaatgcccgagcagcctgtccatgat
gatctggatgatgatgacaatgtttcaatgggggcaccagatagtccagattctgtggat
ccagtggaaccccttccaaccatgactgatcaaacaaccctggttcccaatgaagaggaa
gcatttgccctggaacccattgatatcactgtcaaggagaccaaggctaaaaggaagagg
aaactgattgtggacagtgttaaagagttggatagcaagactattcgtgcccaactcagc
gattactcggacattgttactacactggatttggctcctcctacaaagaagctgatgatg
tggaaggagactggtggtgtggagaaattgttttcattgcctgcccagccattatggaac
acccggttgcttaagctgtttacacgctgtctcacaccacttgttctcgatgatctccga
aagcgaaggaaaggaggtgaagcagataatcttgatgaattcctcaaggagtttgagaat
ccagaagtcccaagagaagaactgcgtcctcaagatgttattgatcaacccatcttggaa
gaagccagtcatctgcaagagtcattgatggagggtagtcgaactcacttggatgatact
ataatgccaccacctccacctaaacaaggagttaaacgtgactccttgcaaatggaacca
gagccgatgcccatgatgcaggaagcagaaccacagattgaaatgccaccacctccactt
ccccctccattggaacttccaccagaagagcctcagagcatcagtgacttaatccctgag
ttaaatctcctgccagaaaaggagaaggaaaaggatgaggaggaggaagaagaggaggaa
gataccacggggactgagcaggatcaagaggagaggcggtggaataagagaacacagcag
atgctccatggtcttcagcgagttcttgctaaaacaggagccgaatccatcagtttgctt
gacctgtgcagaaacacaaaccgaaagcaagcggccgccaaattctacagtttcctggtc
cttaaaaagcagcaagctatagaattgacccagcgggagccttacagcgacatcgttgct
accccaggaccgaggttccacaccgtttga

DBGET integrated database retrieval system