KEGG   Xenopus laevis (African clawed frog): 399139Help
Entry
399139            CDS       T01010                                 

Gene name
smug1, xsmug1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    399139 (smug1)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     399139 (smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 281 aa AA seqDB search
MAAEACVPAEFSKDEKNGSILSAFCSDIPDITSSTESPADSFLKVELELNLKLSNLVFQD
PVQYVYNPLVYAWAPHENYVQTYCKSKKEVLFLGMNPGPFGMAQTGVPFGEVNHVRDWLQ
IEGPVSKPEVEHPKRRIRGFECPQSEVSGARFWSLFKSLCGQPETFFKHCFVHNHCPLIF
MNHSGKNLTPTDLPKAQRDTLLEICDEALCQAVRVLGVKLVIGVGRFSEQRARKALMAEG
IDVTVKGIMHPSPRNPQANKGWEGIVRGQLLELGVLSLLTG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaagcttgcgtgccggcagagtttagcaaagatgaaaaaaatggatcaatt
ctttctgcattttgttctgatatacccgacatcacttcttctactgagagtccagccgac
agtttcctgaaagtggaactggaactgaacttgaaactgtcaaatctggttttccaggac
cccgtacaatatgtgtacaatcctttggtatatgcgtgggcacctcatgagaattatgtg
cagacatactgcaagtccaaaaaggaggtcttgtttttgggtatgaacccagggccattt
ggcatggcacaaacaggggttccctttggggaggttaatcatgtacgtgactggttgcag
attgaagggcctgtatcaaagccagaagtagagcatccaaaaaggcgaatacgtgggttt
gaatgtcctcagagtgaagtgagtggtgctcgattctggagtttgttcaagtcactgtgt
ggccaacctgagacttttttcaagcactgctttgtacacaaccactgtcctcttatcttc
atgaaccattcaggcaagaatctgaccccaacagaccttcctaaggcacagcgggacacc
ttgctggagatatgtgatgaagccctttgccaagctgttagggtacttggagtaaaattg
gttattggagttggaaggttctctgagcaacgtgcaagaaaagccctaatggcagaagga
attgatgttactgtaaaaggaataatgcatccttctcccaggaacccacaggctaacaaa
ggctgggaaggcatagttaggggccagttgctggaactcggagttttatctttactaact
ggctga

DBGET integrated database retrieval system