KEGG   Xenopus laevis (African clawed frog): 399142Help
Entry
399142            CDS       T01010                                 

Gene name
pten
Definition
phosphatase and tensin homolog (EC:3.1.3.67 3.1.3.16 3.1.3.48)
Orthology
K01110  
phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
p53 signaling pathway
mTOR signaling pathway
Focal adhesion
Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    399142 (pten)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    399142 (pten)
   04070 Phosphatidylinositol signaling system
    399142 (pten)
   04150 mTOR signaling pathway
    399142 (pten)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    399142 (pten)
  Cell communication
   04510 Focal adhesion
    399142 (pten)
   04530 Tight junction
    399142 (pten)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     399142 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     399142 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     399142 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 402 aa AA seqDB search
MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQLLSENENVAA
IHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL
LKNSLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVYQLKVKIFTSTAGPKRAEKLMYFD
FPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWVNTFFIPGPEEYSEKVENGTLVGEQELD
GIYSTERSDNDKEYLTLALTKNDLDKANKDKANRLFSPNFKVKLFFTKTVEESSNSEASS
STSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQITQITKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaggagttcgttagtaggaacaagaggcgctaccaggaggatgga
ttcgacttggacctcacctatatttatccaaacattattgccatgggttttcctgcggag
agacttgaaggtgtatacagaaataacatagatgatgtagtgagatttctggactcaaag
cataaaaatcattacaagatctacaatttgtgtgcggagagacattatgataccaacaaa
tttagctgcagagttgcacagtatccgtttgaagaccacaacccaccacagctagagctc
atcaaacctttctgtgaagatcttgaccagttgttaagtgagaatgagaacgtagcagct
atacattgtaaagccggcaagggccggacgggtgttatgatttgtgcctatttgctacac
agaggcaaatttcctagagcacaagaagccctagatttttatggagaagtacggaccaga
gataaaaagggagtcacaatccccagccaaaggcgctatgtatattactatagctacttg
ttaaaaaatagcctggaatacagaccggtgcccctgctctttcacaagattgagtttgaa
acaattccaatgttcagtggctcaacatgcaatccccagtttgtggtttaccagctgaaa
gtcaagatcttcacatcaacggcaggtcccaagcgagcagagaagttaatgtattttgat
ttcccccagcctttgcctgtttgcggggacatcaaggtagaatttttccacaaacagaac
aaagtcatgaaaaaggaaaagatgttccatttttgggtaaacacattcttcataccagga
ccggaagagtattcagaaaaagtagaaaatggaacgttagttggggagcaggagcttgac
ggcatctacagtacagaacgttcagataacgacaaggaatatctcaccctcgctttaact
aaaaacgacctagacaaagctaacaaagacaaagccaacagattattttccccaaacttc
aaagtgaagctatttttcaccaagaccgtagaagaatcatcaaactccgaagcgagcagc
tcgacctccgtaacgccggatgttagtgacaatgaacctgatcattatcgatattctgac
accactgactctgatccagagaatgaaccttttgatgaagatcagatcacacaaattaca
aaagtctga

DBGET integrated database retrieval system