KEGG   Xenopus laevis (African clawed frog): 399142Help
Entry
399142            CDS       T01010                                 

Gene name
pten
Definition
phosphatase and tensin homolog (EC:3.1.3.67 3.1.3.16 3.1.3.48)
Orthology
K01110  
phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
p53 signaling pathway
mTOR signaling pathway
Focal adhesion
Tight junction
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:xla00562]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:xla04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xla04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Cellular Processes; Cell communication; Tight junction [PATH:xla04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 402 aa AA seqDB search
MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQLLSENENVAA
IHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL
LKNSLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVYQLKVKIFTSTAGPKRAEKLMYFD
FPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWVNTFFIPGPEEYSEKVENGTLVGEQELD
GIYSTERSDNDKEYLTLALTKNDLDKANKDKANRLFSPNFKVKLFFTKTVEESSNSEASS
STSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQITQITKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaggagttcgttagtaggaacaagaggcgctaccaggaggatgga
ttcgacttggacctcacctatatttatccaaacattattgccatgggttttcctgcggag
agacttgaaggtgtatacagaaataacatagatgatgtagtgagatttctggactcaaag
cataaaaatcattacaagatctacaatttgtgtgcggagagacattatgataccaacaaa
tttagctgcagagttgcacagtatccgtttgaagaccacaacccaccacagctagagctc
atcaaacctttctgtgaagatcttgaccagttgttaagtgagaatgagaacgtagcagct
atacattgtaaagccggcaagggccggacgggtgttatgatttgtgcctatttgctacac
agaggcaaatttcctagagcacaagaagccctagatttttatggagaagtacggaccaga
gataaaaagggagtcacaatccccagccaaaggcgctatgtatattactatagctacttg
ttaaaaaatagcctggaatacagaccggtgcccctgctctttcacaagattgagtttgaa
acaattccaatgttcagtggctcaacatgcaatccccagtttgtggtttaccagctgaaa
gtcaagatcttcacatcaacggcaggtcccaagcgagcagagaagttaatgtattttgat
ttcccccagcctttgcctgtttgcggggacatcaaggtagaatttttccacaaacagaac
aaagtcatgaaaaaggaaaagatgttccatttttgggtaaacacattcttcataccagga
ccggaagagtattcagaaaaagtagaaaatggaacgttagttggggagcaggagcttgac
ggcatctacagtacagaacgttcagataacgacaaggaatatctcaccctcgctttaact
aaaaacgacctagacaaagctaacaaagacaaagccaacagattattttccccaaacttc
aaagtgaagctatttttcaccaagaccgtagaagaatcatcaaactccgaagcgagcagc
tcgacctccgtaacgccggatgttagtgacaatgaacctgatcattatcgatattctgac
accactgactctgatccagagaatgaaccttttgatgaagatcagatcacacaaattaca
aaagtctga

DBGET integrated database retrieval system