KEGG   Xenopus laevis (African clawed frog): 399157Help
Entry
399157            CDS       T01010                                 

Gene name
clock, XClock, Xclk, clk
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 825 aa AA seqDB search
MSSTADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKRRRDQFNILIKELGSMLPGNARRID
KSTVLQKSIDFLQKHKEISAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAVMTDG
NIIYVSESVTSLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTRMLESGSLSSEYLKTKN
ELEFCCHMLRGTADPKEPSTYEFVKFIGNFKSLNNVPNSTHNGFDGALQRSLRPPYEERV
CFVATVRLATPQFIKEMCTVEESNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTRYYITYHQWNSRPEFI
VCTHTVVSYAEVGAERRRERGNEDSPPAITAEKNQDSVSDNHMNTVSLKEALERFDDSRT
PSPSSKSSIKSSSHTAVSDPSSTPTKIPTDTSTPPRQALTGLDKRRSSISSQSMSSQSVS
QPLSQSVMKQTASIQLQQGMTQPMFQFTAQFGAMKHLKDQLEQRTRIIEENIQRQQEELR
KIQDQLQMVHGQGIQMYLQQPAPGLNFGPVQYSSGNSPSIQQLPQFTMQGQVVQTNQLQG
VMNTGHVGAQHIMQQQQLHNTSQQGQQNIHGGHNQQTSLSSQTSGTLTSPLYNTMVISQP
PSGSMVQMPSNIQQSNQGASVTTFPQDRQIRFSQAQQIVTKLVTTPMACGTVMVPSTMFM
GPVVTAYPTFTTQQQQPQTLSFTQHQQNQQDQQTVPTIQQPAHAQLAQQPQQFLQTSRLV
HGNQSTQLILSPFPVQQNTFAPSHQQQLSHHRTDTMSDPSKVQQQ
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgagctccactgcagacagagatgacggtagtatatttgatggactggtagaagaagat
gacaaggataaagcaaagagggtgtctcggaacaaatcggagaaacggagaagagatcag
ttcaatattctcattaaggagcttgggtctatgttgccaggcaatgccagaagaatagac
aaatccacagtgctgcagaaaagcattgacttcctacagaagcataaagaaatcagtgca
cagtcggatgctagcgaaatacgacaagactggaaacctactttccttagtaatgaagaa
tttactcaactcatgctggaggcgctggatggatttttcctggcagttatgacagatgga
aacataatatatgtatctgaaagcgtgacctccttacttgaacacttaccatctgatctt
gttgatcagagtatatttaattttgtccccgagggggaacattcagaagtgtataaaatt
ctgtctacgcggatgttggaaagtggttctttgtcatcggagtatcttaaaacaaaaaat
gaactagaattctgttgccacatgctaagaggcacagccgatcctaaagagccatcaacg
tacgaatttgtaaagtttattggaaacttcaagtctttaaataatgtgcccaactctaca
cataatggatttgatggtgcattacagaggtctctgcggccaccctatgaagagagagtg
tgctttgtagccactgtaaggctagctactccacagttcattaaggaaatgtgcactgta
gaggaatccaatgaagagttcacatcaaggcacagtctggaatggaagtttcttttcttg
gaccacagggcccctccaatcattggatatttgccttttgaggtgctaggaacttctggc
tatgattattatcacgtggatgacctggaaaaccttgcaaaatgccatgaacacttaatg
cagtatggaaaaggcaagtcatgctattacaggttcctgacaaaaggacagcaatggata
tggctgcagacgcgctactatatcacctaccatcagtggaattccaggccagagtttata
gtttgtacgcatactgtagtaagctatgcagaggttggagcagaaagaagacgtgagcgg
ggcaatgaagattcccctcctgccataactgcagaaaaaaatcaggactctgtctcagac
aatcacatgaacacagtcagtctgaaggaagctttggaaagatttgatgacagccgaacg
ccttcaccgtcatccaaaagctcaattaaatcatcctctcacacagcagtttccgaccca
tcatcaacgccaacaaagatcccaacagacacaagcacaccacctagacaagctttaact
ggccttgacaagaggaggtcatcaatcagcagccagtctatgagctctcagtcagtcagt
cagcctctgtcgcagtcagtgatgaagcaaacagcatctattcagctccagcaaggaatg
acacagcccatgtttcagttcacggcgcagtttggagctatgaagcacctgaaggaccag
ctggagcagagaactcggatcattgaagaaaacatccagcggcagcaggaggagctgcgt
aagattcaggaccagttgcaaatggtccatgggcagggaatccagatgtatttacagcaa
ccagcaccagggctaaattttgggccagtacagtactcttctggaaatagcccaagcatt
cagcagttaccgcagttcaccatgcaaggccaagtggtccagactaaccaacttcaaggt
gtcatgaacactgggcatgtgggagctcagcacataatgcagcagcaacagttacacaat
acaagccagcaaggccagcagaacattcatggaggacacaaccagcagacttcactgtct
agccagacatcgggaactctcactagtcctttgtacaacacaatggtgatctcccagcca
ccttcaggtagtatggtacagatgccttccaacatacagcagagcaaccagggagcctct
gttactacatttcctcaggacaggcagattaggttttctcaagctcagcaaattgtcact
aagctggtgaccactcctatggcttgtggaacagttatggtcccaagcacaatgtttatg
ggcccagtggttactgcctaccctacatttactacacagcagcagcaacctcaaacctta
tcattcacccagcatcaacaaaatcagcaagaccaacagacagtgcctacaatacagcag
cctgctcacgcacaactagcccagcagccacaacagtttttgcagacctcgaggttggtt
catggaaaccagtccacacagctgattctttcccctttccctgtgcaacagaacactttt
gccccatcccaccagcagcagttatcccatcacaggactgacactatgagtgatccttcc
aaggtgcagcaacagtag

DBGET integrated database retrieval system