KEGG   Xenopus laevis (African clawed frog): 399157Help
Entry
399157            CDS       T01010                                 

Gene name
clock, XClock, Xclk, clk
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    399157 (clock)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     399157 (clock)
Transcription factors [BR:xla03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    399157 (clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 825 aa AA seqDB search
MSSTADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKRRRDQFNILIKELGSMLPGNARRID
KSTVLQKSIDFLQKHKEISAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAVMTDG
NIIYVSESVTSLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTRMLESGSLSSEYLKTKN
ELEFCCHMLRGTADPKEPSTYEFVKFIGNFKSLNNVPNSTHNGFDGALQRSLRPPYEERV
CFVATVRLATPQFIKEMCTVEESNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTRYYITYHQWNSRPEFI
VCTHTVVSYAEVGAERRRERGNEDSPPAITAEKNQDSVSDNHMNTVSLKEALERFDDSRT
PSPSSKSSIKSSSHTAVSDPSSTPTKIPTDTSTPPRQALTGLDKRRSSISSQSMSSQSVS
QPLSQSVMKQTASIQLQQGMTQPMFQFTAQFGAMKHLKDQLEQRTRIIEENIQRQQEELR
KIQDQLQMVHGQGIQMYLQQPAPGLNFGPVQYSSGNSPSIQQLPQFTMQGQVVQTNQLQG
VMNTGHVGAQHIMQQQQLHNTSQQGQQNIHGGHNQQTSLSSQTSGTLTSPLYNTMVISQP
PSGSMVQMPSNIQQSNQGASVTTFPQDRQIRFSQAQQIVTKLVTTPMACGTVMVPSTMFM
GPVVTAYPTFTTQQQQPQTLSFTQHQQNQQDQQTVPTIQQPAHAQLAQQPQQFLQTSRLV
HGNQSTQLILSPFPVQQNTFAPSHQQQLSHHRTDTMSDPSKVQQQ
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgagctccactgcagacagagatgacggtagtatatttgatggactggtagaagaagat
gacaaggataaagcaaagagggtgtctcggaacaaatcggagaaacggagaagagatcag
ttcaatattctcattaaggagcttgggtctatgttgccaggcaatgccagaagaatagac
aaatccacagtgctgcagaaaagcattgacttcctacagaagcataaagaaatcagtgca
cagtcggatgctagcgaaatacgacaagactggaaacctactttccttagtaatgaagaa
tttactcaactcatgctggaggcgctggatggatttttcctggcagttatgacagatgga
aacataatatatgtatctgaaagcgtgacctccttacttgaacacttaccatctgatctt
gttgatcagagtatatttaattttgtccccgagggggaacattcagaagtgtataaaatt
ctgtctacgcggatgttggaaagtggttctttgtcatcggagtatcttaaaacaaaaaat
gaactagaattctgttgccacatgctaagaggcacagccgatcctaaagagccatcaacg
tacgaatttgtaaagtttattggaaacttcaagtctttaaataatgtgcccaactctaca
cataatggatttgatggtgcattacagaggtctctgcggccaccctatgaagagagagtg
tgctttgtagccactgtaaggctagctactccacagttcattaaggaaatgtgcactgta
gaggaatccaatgaagagttcacatcaaggcacagtctggaatggaagtttcttttcttg
gaccacagggcccctccaatcattggatatttgccttttgaggtgctaggaacttctggc
tatgattattatcacgtggatgacctggaaaaccttgcaaaatgccatgaacacttaatg
cagtatggaaaaggcaagtcatgctattacaggttcctgacaaaaggacagcaatggata
tggctgcagacgcgctactatatcacctaccatcagtggaattccaggccagagtttata
gtttgtacgcatactgtagtaagctatgcagaggttggagcagaaagaagacgtgagcgg
ggcaatgaagattcccctcctgccataactgcagaaaaaaatcaggactctgtctcagac
aatcacatgaacacagtcagtctgaaggaagctttggaaagatttgatgacagccgaacg
ccttcaccgtcatccaaaagctcaattaaatcatcctctcacacagcagtttccgaccca
tcatcaacgccaacaaagatcccaacagacacaagcacaccacctagacaagctttaact
ggccttgacaagaggaggtcatcaatcagcagccagtctatgagctctcagtcagtcagt
cagcctctgtcgcagtcagtgatgaagcaaacagcatctattcagctccagcaaggaatg
acacagcccatgtttcagttcacggcgcagtttggagctatgaagcacctgaaggaccag
ctggagcagagaactcggatcattgaagaaaacatccagcggcagcaggaggagctgcgt
aagattcaggaccagttgcaaatggtccatgggcagggaatccagatgtatttacagcaa
ccagcaccagggctaaattttgggccagtacagtactcttctggaaatagcccaagcatt
cagcagttaccgcagttcaccatgcaaggccaagtggtccagactaaccaacttcaaggt
gtcatgaacactgggcatgtgggagctcagcacataatgcagcagcaacagttacacaat
acaagccagcaaggccagcagaacattcatggaggacacaaccagcagacttcactgtct
agccagacatcgggaactctcactagtcctttgtacaacacaatggtgatctcccagcca
ccttcaggtagtatggtacagatgccttccaacatacagcagagcaaccagggagcctct
gttactacatttcctcaggacaggcagattaggttttctcaagctcagcaaattgtcact
aagctggtgaccactcctatggcttgtggaacagttatggtcccaagcacaatgtttatg
ggcccagtggttactgcctaccctacatttactacacagcagcagcaacctcaaacctta
tcattcacccagcatcaacaaaatcagcaagaccaacagacagtgcctacaatacagcag
cctgctcacgcacaactagcccagcagccacaacagtttttgcagacctcgaggttggtt
catggaaaccagtccacacagctgattctttcccctttccctgtgcaacagaacactttt
gccccatcccaccagcagcagttatcccatcacaggactgacactatgagtgatccttcc
aaggtgcagcaacagtag

DBGET integrated database retrieval system