KEGG   Xenopus laevis (African clawed frog): 399170Help
Entry
399170            CDS       T01010                                 

Gene name
akt1.S, akt-1, pkb, v-akt, v-akt1, xAct
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 1 S homeolog
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla04933  AGE-RAGE signaling pathway in diabetic complications
Module
xla_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399170 (akt1.S)
   04012 ErbB signaling pathway
    399170 (akt1.S)
   04370 VEGF signaling pathway
    399170 (akt1.S)
   04371 Apelin signaling pathway
    399170 (akt1.S)
   04068 FoxO signaling pathway
    399170 (akt1.S)
   04150 mTOR signaling pathway
    399170 (akt1.S)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    399170 (akt1.S)
  Cell growth and death
   04210 Apoptosis
    399170 (akt1.S)
   04218 Cellular senescence
    399170 (akt1.S)
  Cellular community - eukaryotes
   04510 Focal adhesion
    399170 (akt1.S)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    399170 (akt1.S)
   04625 C-type lectin receptor signaling pathway
    399170 (akt1.S)
  Endocrine system
   04910 Insulin signaling pathway
    399170 (akt1.S)
   04920 Adipocytokine signaling pathway
    399170 (akt1.S)
   04914 Progesterone-mediated oocyte maturation
    399170 (akt1.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    399170 (akt1.S)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    399170 (akt1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399170 (akt1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   399170 (akt1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 399170
NCBI-ProteinID: NP_001083878
Xenbase: XB-GENE-484957
UniProt: Q98TY9
Position
8S
AA seq 481 aa AA seqDB search
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAKC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREEWIQVIQHVADNLKKQEEEMMEV
RSGDSPSDNSGAEEMEVSHSKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLLPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEK
KLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNFEFVDNERRPHFPQFSYSASGN
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtagcgatagtgaaggaaggctggctgcacaaaagaggtgaatacataaag
acctggcgtccccgctacttcctcctcaaatctgacggtactttcattgggtacaaagag
cgtccacaagatgttgaccagttggaaactcctttaaataatttctctgtagccaaatgt
cagctgatgaagacagaacgaccaaaaccaaacacatttatcattcggtgcctccagtgg
accacagtaattgaaagaacatttcatgtggattctccagaggagcgggaagaatggatt
caggtgatacaacatgtagccgacaacctcaagaagcaggaagaagaaatgatggaggtt
cggtccggcgactcgccaagtgataattctggagctgaggaaatggaagtttctcattcg
aaaccaaaacataaagttacaatgaatgaatttgagtatctcaagcttttggggaaagga
acgtttggaaaagttattttagtaaaagagaaagcaacaggacgatattacgctatgaaa
attttaaaaaaagaagttattgttgcaaaggatgaagtagcccacacgcttacggaaaac
cgcgtcctacagaattctaggcatcccttcctaacagcattaaaatattcttttcagact
catgatcgcttatgttttgtgatggagtatgccaatggaggagagttattcttccactta
tcaagagaacgtatattctctgaagatcgtgcccggttttatggggcagagattgtttct
gctttagattatcttcattctgagaaaaatgtagtttacagagacttgaagttggaaaat
ctaatgctggacaaagacggacacataaagataacagattttggactgtgcaaagaagga
ataaaagatggagcaaccatgaagaccttctgtggaacaccagaatatcttgctcctgag
gtgctagaagataatgactatggtcgtgctgtagactggtggggcttgggcgtagtgatg
tacgagatgatgtgcgggcgcctccctttctacaatcaggaccatgaaaaattgtttgaa
cttattcttatggaagaaattagattcccacgcactttattgccagaagccaagtctttg
ctgtctggtttgttgaagaaggaccctaagcaaaggttaggtggtgggccagacgatgca
aaagaaatcatgcaacacaaattttttgctggaatagtatggcaagatgtttatgagaag
aagcttgttcccccatttaagccacaagtaacgtcagaaacagacacaaggtattttgat
gaagaattcacagcgcagatgatcaccatcacaccacctgaccaagatgacaatttcgaa
tttgtagacaacgagaggcggccgcacttcccccagttttcatactctgctagtggaaat
gcttag

DBGET integrated database retrieval system