KEGG   Xenopus laevis (African clawed frog): 399172Help
Entry
399172            CDS       T01010                                 

Gene name
prkaa2, ampk, ampk2, prkaa, prkaa1
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit (EC:2.7.11.1)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:xla04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 560 aa AA seqDB search
MRRLSSLMKMAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVAGGELFDYICKNG
KLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPPVISLLKHMLLVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSTNMID
DEALKEVCDKCECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FMEEPPISRPHPERVPFLIAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPND
IMAEVCRAMKQLGYEWKLVNPYYLRVRRKNPVTSMCTKMSLQLYQVDSRTYLLDFRSIDD
EVTESKSESATPRRSGSISNYRPPRNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLLPRP
GSHTIEFFEMCANLIKILAR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcagttcgctcatgaagatggcggcggataaacagaagcatcatgacggg
agggtgaagatcggtcactatattctgggcgacacgcttggggtgggcacgtttggcaaa
gtgaaagttggcaaacatgagctgacgggacacaaggttgcagtgaagattttaaaccgg
cagaagatccgcagcctcgatgtggttgggaaaattcgccgcgagatccagaacctgaag
ctcttccggcatcctcatattattaagctgtaccaggtcatcagcacgccaactgatatc
tttatggttatggaatatgttgctggcggggaactctttgattatatttgcaagaatggc
aagttggatgaaaaggaatcccggcgcttgttccagcaaattctttctggcgttgattat
tgccatagacatatggttgtacacagagacttgaagcctgagaatgttctcctcgatgcc
cacatgaatgcaaagattgcagattttgggctctctaacatgatggctgatggtgaattc
ctacgaactagctgtggctcccctaactatgctgcaccggaagttatttcaggaagactt
tatgctggcccagaggtggacatatggagctgcggggttatcctatacgctttactctgc
ggaactcttccgtttgatgatgatcacgtgccaacactttttaagaagatatgtgacggc
atcttctacacaccccagtacctgaatcctcccgtcattagccttctaaagcacatgcta
ttggtcgatcccatgaagagagcaacgattaaagatattcgggaacacgaatggttcaag
caagatcttcccaaatatctgtttcccgaggacccatcgtacagtacaaatatgatcgat
gacgaagccttaaaggaagtgtgtgataagtgtgagtgtacggaggaggaagtgctgagc
tgcttgtacagtcgcaaccaccaggatccattagccgtcgcctaccatctgatcatagat
aatcgcaggataatgaacgaggccaaagacttctatttggcaactagtcctccggattcc
ttcatggaagagcctcctatatcccggcctcacccagagagagtgccctttttaatagcg
gagtcgcctcggcaacggcacacactcgatgagttgaacccgcaaaagaccaaacaccaa
gttggtgtaagaagagccaaatggcatcttggcattcgaagtcagagccgaccaaatgat
attatggccgaggtttgccgagcaatgaaacaactgggctatgaatggaagcttgtgaat
ccttactacctgcgtgtgagaaggaagaacccagtgactagcatgtgcactaagatgagc
ctccagctgtaccaagtggatagcagaacttacctgctggatttccgcagcattgacgat
gaagttactgaatccaagtcggaaagcgccacccctaggagatcaggctccattagcaat
taccgacctccaagaaacgactcggatcctgaaattcaagcaaagtcttcagacggctca
gggccgtcctccttaacctcatcagtggactcttccaacgccgacttactccccaggcct
ggaagccataccatcgaattttttgaaatgtgcgcaaatctaataaaaatcctcgcacga
taa

DBGET integrated database retrieval system