KEGG   Xenopus laevis (African clawed frog): 399215Help
Entry
399215            CDS       T01010                                 

Gene name
ppp3r1, canb
Definition
protein phosphatase 3, regulatory subunit B, alpha (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399215 (ppp3r1)
   04310 Wnt signaling pathway
    399215 (ppp3r1)
   04370 VEGF signaling pathway
    399215 (ppp3r1)
   04020 Calcium signaling pathway
    399215 (ppp3r1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    399215 (ppp3r1)
   04210 Apoptosis
    399215 (ppp3r1)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     399215 (ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADRDGDGKISFEEFCVVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagcaagctatccattggaaatgtgctcacatttcgatgcggacgagatc
aaaaggctggggaaaaggttcaagaagctggatttagacaactccggttcgttgagtgtg
gaggagttcatgtcgttgccggagcttcagcagaaccctcttgtgcaacgagtaatagac
atatttgacacggatggaaacggagaagtagacttcaaagagtttatcgaaggagtgtcc
cagttcagtgtcaaaggtgataaggagcagaaactgaggtttgctttccgtatatacgac
atggacaaggacggctacatctccaatggtgagctcttccaggtactgaagatgatggtg
ggaaacaatctgaaagacacccagttacagcaaatagtagacaaaaccattatcaacgca
gatagagatggagatggaaaaatatcctttgaagaattctgtgttgtcgtaggaggttta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system