KEGG   Xenopus laevis (African clawed frog): 399248Help
Entry
399248            CDS       T01010                                 

Gene name
p4hb
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    399248 (p4hb)
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     399248 (p4hb)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   399248 (p4hb)
  Exosomal proteins of colorectal cancer cells
   399248 (p4hb)
  Exosomal proteins of bladder cancer cells
   399248 (p4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 506 aa AA seqDB search
MMRAVLLFGCALLVVARPDISEEKDVLVLKKDNFDEALKQYPYILVEFYAPWCGHCKALA
PEYEKAAGILKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKSSPKEYSAGR
EAADFVNWLKKRTGPAASTLSDEAAVAALVASSEVAVIGFFKDLESELAKVFLQAAEAVD
DVPFGITSSEAAFSKHELGKDGIVLFKKFDEGRNAFEGEITKEEVLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSASDYQDKLENFKKAAASFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESSDLSAEAIKEFCDRFLEGKVKPHLMSQDV
PEDWDKTPVKILVGKNFEEVVFDEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHESI
IIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKKVVDYNGERTQEGFSKFLESGGQDGAAD
EDLEDLEEADETDLEEGDDIHTKDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgctgttcttcttttcggctgtgctcttttggtcgttgccaggcctgatatt
tccgaggagaaggatgtgctggtgctgaagaaagacaactttgatgaggcgctcaagcag
tatccgtatatcttagtggagttctatgctccctggtgtggtcactgcaaggcactggct
ccagaatatgagaaggctgctggcatattaaaaagtgaaggcttgccaatacgcttgggc
aaggtagatgctacagaagagtctgatctggcacaggagtttggcgtccgaggttaccca
acaatcaagttcttcaaaaatggagacaagtcttctcctaaagaatattcagctggcagg
gaggcagcagattttgtcaactggctgaagaagcgtactggtccggctgccagtactttg
agtgatgaggcagctgttgcagctttggtggcttccagtgaggttgcagttattggtttc
tttaaggatctggagtcagagttagctaaagtgttcctgcaagcagcagaggcagtggat
gatgttccatttggcattacttccagtgaggcagctttctcgaaacatgaactcggcaag
gatggcatagttctgtttaagaagtttgatgaaggccgaaatgcatttgagggagagatc
accaaagaagaagttctgagcttcataaaggccaatcggttgcctctagttatagaattt
actgagcagactgctccaatgatcttcgggggagagattaagactcatattctcttcttt
ttgccgaaaagtgcctctgattaccaagacaaattagagaacttcaagaaggcagccgca
agcttcaaaggaaagatcctcttcatctttattgatagtgatcacacagacaaccaacgt
attctggagttctttggcttaaagaaagaagaatgcccagctgtccggcttattactttg
gaggaagaaatgacaaaatacaagccagagagttctgatctttcagcagaggcaattaaa
gagttctgtgaccgtttcctagagggcaaagtcaagccacacttaatgagccaggatgtt
ccagaagattgggacaagacccctgtgaaaatcttggttgggaagaactttgaggaagtg
gtctttgatgaggagaagaatgtatttgtagaattctatgctccatggtgtggtcactgc
aaacaactggcaccgatctgggaccagttgggggagaagtataaggaccacgaaagcatc
atcattgccaagatggattctacagccaatgagatagaagctgttaagattcacagcttc
cctacgctgaagtttttccctgctggaccaggaaagaaggtggttgattataatggtgaa
aggacccaagaaggcttttcaaagtttttggagagtggggggcaggatggagctgctgat
gaggatcttgaagatttagaagaagctgatgaaactgatttggaggagggagatgacatc
catacaaaagatgaattataa

DBGET integrated database retrieval system