KEGG   Xenopus laevis (African clawed frog): 399252Help
Entry
399252            CDS       T01010                                 

Gene name
hdac2
Definition
histone deacetylase 2 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    399252 (hdac2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    399252 (hdac2)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     399252 (hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 488 aa AA seqDB search
MAYTQGGAKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARLEEDKKETDDKKSDVKEEDKSKDNIAEKMDTKGV
KSEQPINP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatacgcaggggggtgccaagaagaaggtctgctactattatgatggtgatatt
ggaaattactactatggccaagggcatccaatgaagcctcacagaatccgcatgacccat
aatttgctgctgaactatggcctttatagaaaaatggaaatctatagacctcacaaggca
acagctgaagagatgaccaagtatcacagtgatgaatatataaaatttcttcgatcaata
cgaccagacaatatgtctgaatacagcaaacaaatgcagaggtttaatgtgggtgaagac
tgccctgtgtttgatggtctctttgagttttgtcagctgtctactggtgggtctgtagct
ggtgctgtaaaactcaaccgccaacaaacagatatggctgttaactgggcaggaggcctt
catcatgctaagaaatcagaagcatctggattctgttatgttaatgatattgttcttgga
atccttgaacttttgaagtatcaccaaagagtgttatatattgatattgatatccatcat
ggtgatggtgttgaagaggcattttataccaccgatcgtgtcatgaccgtgtcatttcac
aagtatggtgaatactttcctggcactggagatcttcgggatattggtgctggaaaaggt
aaatattatgctgtcaattttccaatgagggatgggattgatgatgagtcgtatggacaa
atctttaaaccaataatctctaaggtaatggagatgtatcagcccagcgcagttgttcta
cagtgtggtgcagactctctttctggtgaccgtcttggatgctttaatctgactgttaaa
ggtcacgcaaagtgtgtggaagtggtaaagacatttaatttgcctttgttgatgcttgga
ggaggtggatatactatacgtaatgttgctcgatgctggacatatgagactgctgttgca
ctggactgtgaaatcccaaatgagctaccatataatgattactttgaatattttggacct
gacttcaagttgcatattagcccttctaatatgacaaatcaaaatactcctgaatacatg
gagaaaataaagcagcgcttatttgaaaacttgcgtatgctgcctcatgctcctggagta
cagatgcaggctattccagaggatgctgtacaggaggacagtggtgatgaggaaggagaa
gacccagacaaacgcatttcaatacgagcttctgacaagcggatagcttgtgatgaggag
ttttcggactctgaggatgaaggtgaaggaggaagacgtaatgtagcagatcacaaaaag
ggagcaaaaaaagcaagacttgaagaagacaaaaaggaaacggatgacaagaaatctgat
gtcaaagaagaggataaatccaaggacaacattgcagagaaaatggacacaaaaggtgtt
aagtccgaacagccaattaatccatga

DBGET integrated database retrieval system