KEGG   Xenopus laevis (African clawed frog): 399281Help
Entry
399281            CDS       T01010                                 

Gene name
fth1.L, apoferritin, ferritin, fhc, fth, fth1, fth1-a, fth1-b, fthl6, ftn-2, pig15, plif
Definition
(RefSeq) ferritin, heavy polypeptide 1 L homeolog
  KO
K00522  
ferritin heavy chain [EC:1.16.3.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Ferroptosis
Necroptosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    399281 (fth1.L)
   04217 Necroptosis
    399281 (fth1.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     399281 (fth1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   399281 (fth1.L)
  Exosomal proteins of bladder cancer cells
   399281 (fth1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
7L
AA seq 176 aa AA seqDB search
MQSQVRQNFHSDCEAAINRMVNMEMYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEER
EHAEKFLKYQNKRGGRVVLQDIKKPERDEWGNTLEATQAALQLEKTVNQALLDLHKLASD
KVDAHLCDFLESEYLEEQVKAMKQLGDYITNLKRLGVPQNGMGEYLFDKHTLGESS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcccaggtgcgccagaacttccacagcgactgcgaagccgccatcaaccggatg
gtgaacatggagatgtatgcctcctatgtctacctgtccatgtcttactatttcgatcgt
gatgatgtggcactccatcatgtggccaagttcttcaaggagcagagtcatgaggaaagg
gagcacgccgaaaagttcctcaaataccaaaacaaacgtgggggccgtgtcgtccttcag
gatatcaagaaaccagagcgtgatgaatggggtaacaccctggaagccacgcaggccgct
ctgcaactggagaagaccgtgaaccaagccttactggatctgcacaagctggcatccgac
aaggttgatgctcatctctgcgacttccttgaatctgagtacttggaagaacaggtgaag
gccatgaagcagcttggagactacatcaccaacctgaagcgccttggggtaccgcagaac
ggcatgggcgagtacctgttcgacaagcacaccctgggggagagtagctaa

DBGET integrated database retrieval system