KEGG   Xenopus laevis (African clawed frog): 399299Help
Entry
399299            CDS       T01010                                 

Gene name
irs1, irs-1, irs1-a
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    399299 (irs1)
   04150 mTOR signaling pathway
    399299 (irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399299 (irs1)
   04920 Adipocytokine signaling pathway
    399299 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 885 aa AA seqDB search
MNIRRCGHSENFFFIEVGRSAVTGAGEFWMQVDDSVVAQNMHETILEAMKALSDEFRPRS
KSQSSSNCSNPISVPLRRHHLNHPPPSQVGLNRRARTESATATSPAGGAAKHGSSSFRVR
ASSDGEGTMSRPASMEGSPVSPSASRTQSHRHRGSSRLHPPLNHSRSIPMPATRCSPSAT
SPVSLSSSSTSGHGSTSDCMCPRRSSASISGSPSDGGFISSDEYGSSPCDFRSSFRSVTP
DSMGHTPPAREEELNNYICMGKSSSHLQRGPQQRYQPSRGEELTDFDKVFRKRTHSSGTS
PPTVSHQKTPSQSSIEEYTEMMPTHPVRLTSFRHSAFVPTYSYPEECLDLHLEGSRANHK
DDGYMPMSPGVAPVSTKTNDYMPMSPKSVSAPQQIINPRWHSAVDSNGYMMMSPSGSCSP
DNTNYSKIWTNGTNPKLSIDSIEGKLPCSDYINMSPASGSTTSTPPDSYLNSVEESTKPV
YSYFSLPRSFKHVHRKSEDGNLRISANSGHNLYTEDSSSSSTSSDSLGGQDPQQPRKGEG
CIQGKRLTRPTRLSLENSSKASTLPRVREPALPPEPKSPGEYVNIEFNDKVFSGGLVPSM
CSLPFVQSRVVPQRENLSEYMNMDLGVWRAKTSYASTSSYEPPNKPVNSVCPTETCSSSR
PPIRGKPISRDYMSMQLGSLCPDYSQVPPTRLSAKSITLSSSKSNYAEMSSGRVSDNIPA
IAPASNSSLSEASRSSLLGQGSGPSAFTRVSLSPNRNPSAKVIRAGDPQGRRRHSSETFS
STPTTARVTTGPVSGEDVKRHSSASFENVWLRPGEIARRDSLQPSDHTHNGLNYIDLDLA
KDLSSLDHCNSHQSGVSHPSDDLSPYASITFHKLEEHRSQAETEE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaggagatgtgggcattcagaaaattttttctttattgaagtgggtcgttct
gcagtcacgggagctggtgaattctggatgcaagtggatgattctgtagttgctcagaac
atgcatgaaaccatactagaagctatgaaagctctaagcgatgaatttcggcctcggagt
aaaagtcagtcttcatctaactgctctaatcctatatctgtacctcttaggaggcatcac
cttaatcatccaccacccagccaggtagggcttaatagaagagctcgtacagagagtgct
actgccacatcacctgctgggggtgcagcaaagcatggatcatcctctttcagagtccgg
gcatctagtgatggcgaaggaacaatgtcaaggccagcctccatggaaggtagcccagta
agtcccagtgcaagcagaactcagtcacatcggcatcggggtagttctcgacttcaccca
ccacttaaccatagtcggtctataccaatgccagcgactcgctgctctccttcagctacg
agccctgtaagcttgtcctccagtagtacaagtggacatggttccacttctgattgcatg
tgccctcgtagatccagtgcctccatttctggttcccccagtgatggtggttttatttct
tcagatgaatatgggtctagcccatgtgattttagaagttcctttcgcagtgtaacacca
gattctatgggtcacactccaccagctagggaggaagagctaaataattatatttgcatg
ggcaaatccagtagtcatctccagagaggcccacagcagaggtaccagccaagtcgaggg
gaagagctgactgactttgacaaggtttttagaaagaggactcactcctcaggaacatct
ccacctacagtttcacaccagaagacgccatcacagtcatctattgaggaatatacagag
atgatgcctactcatcctgtgcgtttaacatcatttaggcattctgcatttgtacccacc
tactcttatccagaagagtgcctagacctccatttggagggtagcagagctaaccacaaa
gatgatggatacatgcctatgtcacctggtgttgctcctgtgtctacaaaaacaaatgac
tatatgcctatgagccctaagagtgtgtctgccccccaacagatcattaaccccagatgg
cactctgctgtagattcaaatggttatatgatgatgtcacccagtggtagctgttctcca
gataataccaattacagcaagatatggaccaatggtaccaatccaaagttgtccatagat
agcattgagggcaaactgccttgtagtgactacattaatatgtctcctgctagtggctcc
actacaagtacgcctccagactcttatctgaattctgttgaagagtcaacaaagcctgta
tattcatacttttccttgcccaggtccttcaaacatgttcacaggaaaagtgaagatggc
aatttgcgcatctctgcaaattctgggcataatctatacactgaggactcttcctcctct
tccacaagcagtgatagtctagggggtcaagaccctcagcagcctagaaagggagagggc
tgcattcaggggaagagattgactagacccaccaggctttcattggaaaacagcagtaag
gccagcactctgcccagggtgagagaacctgctttgcccccagagccaaaaagtcctggg
gagtatgttaatatagagttcaatgacaaggtattttctgggggcttggtgccttccatg
tgttcccttccttttgtgcagagcagagttgtgcctcaaagggagaacttatctgaatac
atgaacatggatcttggagtttggagagctaaaacatcctatgcttccacttcatcatat
gaaccacccaacaagccggttaactccgtgtgccctactgaaacttgcagtagtagtcga
ccacccattagagggaagccaatctcacgagactatatgagcatgcaacttggttccctg
tgtcctgattacagccaagtcccacctaccaggttaagtgccaagtccatcactctttct
tctagtaaaagtaattatgcagagatgtcaagtggcagagtttctgataatattcctgct
attgccccagcttctaactccagcctatccgaagcatctcgctcttctcttttgggccag
ggctctggccccagcgcctttactcgggttagtctaagcccaaaccgtaatccgagtgcc
aaagtcatcagggccggggacccacagggtcggagacggcacagctcagagacattctcc
tcaactcctactacagccagagttactactggcccagtttctggggaggatgtcaagaga
cacagctctgcctcctttgaaaatgtgtggcttaggcctggagagattgccaggagagat
tcccttcagccttctgatcacacacataatggcctgaattatattgacttggatctagct
aaggatttgagtagcctggatcattgcaactcccaccaatctggcgtaagtcacccatca
gatgacctaagcccatatgccagcatcactttccacaagctggaggagcatcggagtcag
gcagaaacagaagaataa

DBGET integrated database retrieval system