KEGG   Xenopus laevis (African clawed frog): 399299Help
Entry
399299            CDS       T01010                                 

Gene name
irs1.S, irs-1, irs1, irs1-a
Definition
(RefSeq) insulin receptor substrate 1 S homeolog
  KO
K16172  insulin receptor substrate 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Module
xla_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    399299 (irs1.S)
   04150 mTOR signaling pathway
    399299 (irs1.S)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    399299 (irs1.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399299 (irs1.S)
   04920 Adipocytokine signaling pathway
    399299 (irs1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 399299
NCBI-ProteinID: NP_001084092
Xenbase: XB-GENE-478676
UniProt: Q91615
Position
5L
AA seq 885 aa AA seqDB search
MNIRRCGHSENFFFIEVGRSAVTGAGEFWMQVDDSVVAQNMHETILEAMKALSDEFRPRS
KSQSSSNCSNPISVPLRRHHLNHPPPSQVGLNRRARTESATATSPAGGAAKHGSSSFRVR
ASSDGEGTMSRPASMEGSPVSPSASRTQSHRHRGSSRLHPPLNHSRSIPMPATRCSPSAT
SPVSLSSSSTSGHGSTSDCMCPRRSSASISGSPSDGGFISSDEYGSSPCDFRSSFRSVTP
DSMGHTPPAREEELNNYICMGKSSSHLQRGPQQRYQPSRGEELTDFDKVFRKRTHSSGTS
PPTVSHQKTPSQSSIEEYTEMMPTHPVRLTSFRHSAFVPTYSYPEECLDLHLEGSRANHK
DDGYMPMSPGVAPVSTKTNDYMPMSPKSVSAPQQIINPRWHSAVDSNGYMMMSPSGSCSP
DNTNYSKIWTNGTNPKLSIDSIEGKLPCSDYINMSPASGSTTSTPPDSYLNSVEESTKPV
YSYFSLPRSFKHVHRKSEDGNLRISANSGHNLYTEDSSSSSTSSDSLGGQDPQQPRKGEG
CIQGKRLTRPTRLSLENSSKASTLPRVREPALPPEPKSPGEYVNIEFNDKVFSGGLVPSM
CSLPFVQSRVVPQRENLSEYMNMDLGVWRAKTSYASTSSYEPPNKPVNSVCPTETCSSSR
PPIRGKPISRDYMSMQLGSLCPDYSQVPPTRLSAKSITLSSSKSNYAEMSSGRVSDNIPA
IAPASNSSLSEASRSSLLGQGSGPSAFTRVSLSPNRNPSAKVIRAGDPQGRRRHSSETFS
STPTTARVTTGPVSGEDVKRHSSASFENVWLRPGEIARRDSLQPSDHTHNGLNYIDLDLA
KDLSSLDHCNSHQSGVSHPSDDLSPYASITFHKLEEHRSQAETEE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaggagatgtgggcattcagaaaattttttctttattgaagtgggtcgttct
gcagtcacgggagctggtgaattctggatgcaagtggatgattctgtagttgctcagaac
atgcatgaaaccatactagaagctatgaaagctctaagcgatgaatttcggcctcggagt
aaaagtcagtcttcatctaactgctctaatcctatatctgtacctcttaggaggcatcac
cttaatcatccaccacccagccaggtagggcttaatagaagagctcgtacagagagtgct
actgccacatcacctgctgggggtgcagcaaagcatggatcatcctctttcagagtccgg
gcatctagtgatggcgaaggaacaatgtcaaggccagcctccatggaaggtagcccagta
agtcccagtgcaagcagaactcagtcacatcggcatcggggtagttctcgacttcaccca
ccacttaaccatagtcggtctataccaatgccagcgactcgctgctctccttcagctacg
agccctgtaagcttgtcctccagtagtacaagtggacatggttccacttctgattgcatg
tgccctcgtagatccagtgcctccatttctggttcccccagtgatggtggttttatttct
tcagatgaatatgggtctagcccatgtgattttagaagttcctttcgcagtgtaacacca
gattctatgggtcacactccaccagctagggaggaagagctaaataattatatttgcatg
ggcaaatccagtagtcatctccagagaggcccacagcagaggtaccagccaagtcgaggg
gaagagctgactgactttgacaaggtttttagaaagaggactcactcctcaggaacatct
ccacctacagtttcacaccagaagacgccatcacagtcatctattgaggaatatacagag
atgatgcctactcatcctgtgcgtttaacatcatttaggcattctgcatttgtacccacc
tactcttatccagaagagtgcctagacctccatttggagggtagcagagctaaccacaaa
gatgatggatacatgcctatgtcacctggtgttgctcctgtgtctacaaaaacaaatgac
tatatgcctatgagccctaagagtgtgtctgccccccaacagatcattaaccccagatgg
cactctgctgtagattcaaatggttatatgatgatgtcacccagtggtagctgttctcca
gataataccaattacagcaagatatggaccaatggtaccaatccaaagttgtccatagat
agcattgagggcaaactgccttgtagtgactacattaatatgtctcctgctagtggctcc
actacaagtacgcctccagactcttatctgaattctgttgaagagtcaacaaagcctgta
tattcatacttttccttgcccaggtccttcaaacatgttcacaggaaaagtgaagatggc
aatttgcgcatctctgcaaattctgggcataatctatacactgaggactcttcctcctct
tccacaagcagtgatagtctagggggtcaagaccctcagcagcctagaaagggagagggc
tgcattcaggggaagagattgactagacccaccaggctttcattggaaaacagcagtaag
gccagcactctgcccagggtgagagaacctgctttgcccccagagccaaaaagtcctggg
gagtatgttaatatagagttcaatgacaaggtattttctgggggcttggtgccttccatg
tgttcccttccttttgtgcagagcagagttgtgcctcaaagggagaacttatctgaatac
atgaacatggatcttggagtttggagagctaaaacatcctatgcttccacttcatcatat
gaaccacccaacaagccggttaactccgtgtgccctactgaaacttgcagtagtagtcga
ccacccattagagggaagccaatctcacgagactatatgagcatgcaacttggttccctg
tgtcctgattacagccaagtcccacctaccaggttaagtgccaagtccatcactctttct
tctagtaaaagtaattatgcagagatgtcaagtggcagagtttctgataatattcctgct
attgccccagcttctaactccagcctatccgaagcatctcgctcttctcttttgggccag
ggctctggccccagcgcctttactcgggttagtctaagcccaaaccgtaatccgagtgcc
aaagtcatcagggccggggacccacagggtcggagacggcacagctcagagacattctcc
tcaactcctactacagccagagttactactggcccagtttctggggaggatgtcaagaga
cacagctctgcctcctttgaaaatgtgtggcttaggcctggagagattgccaggagagat
tcccttcagccttctgatcacacacataatggcctgaattatattgacttggatctagct
aaggatttgagtagcctggatcattgcaactcccaccaatctggcgtaagtcacccatca
gatgacctaagcccatatgccagcatcactttccacaagctggaggagcatcggagtcag
gcagaaacagaagaataa

DBGET integrated database retrieval system