KEGG   Xenopus laevis (African clawed frog): 399376Help
Entry
399376            CDS       T01010                                 

Gene name
rps6ka3, S6KII, p90, rsk, rsk2
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 3 (EC:2.7.11.1)
Orthology
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399376 (rps6ka3)
   04150 mTOR signaling pathway
    399376 (rps6ka3)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    399376 (rps6ka3)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    399376 (rps6ka3)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399376 (rps6ka3)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   399376 (rps6ka3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 737 aa AA seqDB search
MPLAQLADPWQKVPVQKVESENGQQFADESMCEEDNENNDEGNINEIAITHHVKEGHEKA
DPSQFELLKVLGQGSFGKVFLVRKISGTDAGQLYAMKVLKKATLKVRDRVRTKMERDILV
EVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKYYLAELALALDH
LHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRR
GHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLTPEAQSLLRMLF
KRNPTNRLGAGPDGVEEIKRHPFFVTIDWNKLFRREIQPPFKPATGGPEDTFYFDPEFTA
KTPKDSPGIPASANAHQLFRGFSFVAISSEDENQAMQTVGVHAIVPLHRNSIQFTDGYEL
KEDIGVGSYSICKRCIHKGTNMEYAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYD
DGKYVYLVTELMKGGELLDKILRQKFFSEREASAVLHTITKTAEYLHSQWVVHRDLKPSN
ILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSL
GVLLYTMLTGYTPFANGPEDTPEEILARIGSGKFSLSGGYWNSVSDIAKDLVSKMLHVDP
HQRLTAAQVLKHPWIVHCDQLPQFQLNRQDAPHLVKGAMAATYSALNLNPMSPVLAPVGR
STLAQRRGVKKITSTAL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcagctggcagacccgtggcagaaagtgccggtgcagaaagtggaaagc
gagaacgggcagcagtttgcagatgaatccatgtgtgaggaggacaatgagaacaatgat
gaaggaaatataaacgaaattgcaatcacacaccatgttaaagaaggccatgaaaaggca
gatccttcacagtttgaacttctaaaggttcttgggcaaggctcctttggcaaggtattt
ctggtgcgtaaaatctcaggaacagatgctgggcaattatatgcaatgaaagtattaaaa
aaggcaacacttaaagtccgagatcgtgtcagaacaaaaatggagcgtgatattttggtg
gaagttaatcatccgtttattgtgaaattgcactatgctttccaaacagagggcaagctg
tacctaattttggattttctcaggggtggagatttgtttacacgcttatccaaagaggta
atgttcacagaagaagatgtgaaatattacttggctgaattggcactagccttagaccat
cttcattctcttggaatcatttatcgagacctaaaaccggaaaacatattacttgatgaa
gaaggccacattaaattaaccgattttggccttagtaaggagtctatagaccatgaaaaa
aaagcatattctttctgtggaacggtggaatacatggctccagaggtagtaaatcggcga
ggccacactcagagcgcagactggtggtcttttggtgttctaatgtttgaaatgctcact
ggtaccctaccctttcaaggaaaggacagaaaagaaaccatgaccatgattctgaaagcc
aaactcgggatgcctcagtttttaactcctgaagctcagagtcttctgcgcatgctgttt
aagagaaatcctactaatagactaggtgctggtccagatggagttgaagagattaagaga
caccctttttttgtaacaattgattggaataaattgtttaggagagagattcagccaccc
tttaaaccagccactggtggacccgaagacacattttatttcgatcctgaattcacagca
aaaacgccaaaagattctcctggtatcccagcaagtgccaacgcacaccagctcttccgt
gggtttagctttgttgccatttcatctgaagacgaaaaccaagctatgcaaacggttggg
gttcatgctattgttccacttcataggaacagcatccagttcacagatggctacgagcta
aaggaagatattggggtgggttcctattctatttgcaaaaggtgtattcacaagggcacc
aacatggaatatgcggtaaagattattgacaagagcaagagagatcccactgaggaaatc
gaaatactgttgcgatatgggcagcatcccaatatcattacgttaaaagatgtgtatgat
gatggaaaatatgtgtatttagtaacggaacttatgaaaggaggggaacttttagataaa
atactgcggcaaaagttcttctccgaacgtgaggcaagtgcagtgctgcacacgataacc
aaaaccgcagaatacctccattcccagtgggtcgtccacagggatctcaagccaagcaat
attctttatgtggatgagtctgggaaccctgagtctattagaatttgtgacttcggcttt
gcaaagcaactcagggcagaaaatggtttgcttatgactccatgctacactgcaaatttt
gtggcccctgaggtgttaaagcgtcaaggctatgatgcagcatgtgacatatggagtctg
ggtgtgctgctttatactatgctgacaggatacactccttttgcaaacgggccagaagat
acaccagaagaaatcttagcaagaataggaagtggaaagttctctcttagtggcggctat
tggaattctgtttcagatatcgccaaggacctagtttcaaagatgcttcatgtggatcca
catcaacgattaactgcagcccaggtccttaaacacccctggatagtacactgtgaccag
ctgcctcagtttcagctgaacagacaagatgctccacatctagtaaagggagccatggca
gcaacttattctgccttgaaccttaatccaatgtctccagtactggcacctgttggtcgt
tctactctggctcagaggaggggagtaaagaagattacctccactgccctgtga

DBGET integrated database retrieval system