KEGG   Xenopus laevis (African clawed frog): 399438Help
Entry
399438            CDS       T01010                                 

Gene name
tmsb4x, tmsb4
Definition
thymosin beta 4 peptide
Orthology
K05764  
thymosin, beta 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKAKLKKTETQEKNPLPSKETIEQEKQSTES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggctgagattgagaaattcgataaggccaagctgaagaag
acagaaacacaagaaaagaacccactcccatcaaaagaaacaattgagcaagagaagcaa
tcaactgagtcataa

DBGET integrated database retrieval system