KEGG   Xenopus laevis (African clawed frog): 399463Help
Entry
399463            CDS       T01010                                 

Gene name
gnai1.S, gnai1, gnai1-a, gnai1-b
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 S homeolog
  KO
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Gap junction
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    399463 (gnai1.S)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    399463 (gnai1.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    399463 (gnai1.S)
   04916 Melanogenesis
    399463 (gnai1.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    399463 (gnai1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   399463 (gnai1.S)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    399463 (gnai1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
3S
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgccgaagacaaggcggccgtggagaggagcaaaatgatcgat
aggaacctgagggaggacggagagaaggctgcccgggaggtgaagctgcttctgctcggc
gctggggaatctggcaaaagcacaattgttaaacaaatgaaaatcatccatgaagccggt
tactcagaagaagaatgcaaacagtacaaggcagttgtttacagtaacacaattcaatcc
attattgccattattcgggcaatgggcagactgaagatagattttggtgatccctcaaga
gcggatgacgcacgccagctttttgtattggctggagcagcagaagaaggttttatgact
gcagaactagctggagttataaaaagattatggaaagatggtggtgtacaggcgtgtttc
aacaggtcaagagaatatcagctcaatgactctgcagcatattatcttaacgatttggac
aggatagcacagaacagttacataccaactcaacaggatgttctcaggactagagtgaaa
actacgggcatagtagaaactcattttactttcaaggaccttcatttcaaaatgtttgat
gtgggaggccaaagatctgaaagaaaaaaatggattcattgctttgagggggtcacagca
ataattttctgtgtagcactgagtgattatgatctagttttagctgaagatgaggaaatg
aaccgcatgcatgaaagcatgaagctattcgatagtatctgcaataacaagtggtttaca
gacacttccattattctctttctaaataaaaaagatctttttgaggagaaaatcaagaga
agtcctttaacaatttgttacccagaatatccaggttcaaacacatatgaagaggccgct
gcatacattcagtgtcagtttgaagatctcaataaaagaaaggatacaaaagaaatatac
acgcattttacatgtgctacggataccaagaatgtgcagtttgtgtttgatgcagtaact
gatgtcatcataaaaaataatctgaaagactgtggccttttctaa

DBGET integrated database retrieval system