KEGG   Xenopus laevis (African clawed frog): 414522Help
Entry
414522            CDS       T01010                                 

Gene name
nlk.L, Xnlk, nlk, nlk1, nlk2
Definition
(RefSeq) nemo-like kinase L homeolog
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    414522 (nlk.L)
   04310 Wnt signaling pathway
    414522 (nlk.L)
   04068 FoxO signaling pathway
    414522 (nlk.L)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    414522 (nlk.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     414522 (nlk.L)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   414522 (nlk.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
2L
AA seq 533 aa AA seqDB search
MSLCGTSTNANMMAAYNGGTSTAAGGHHHHHHHHHLAHLPPPHLHHHHHLHPQHHLHPGS
AAAVHPVQQHVSSSSASSSAAAAAAAAAAAAAMLNPGQAQSYFPSPAPGQAPGPAAAVAP
AQVQAAAVKAHHHQHSHHAQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQ
NLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQ
PLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDES
RHMTQEVVTQYYRAPEILMGSRHYTNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLIT
DLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSK
RISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSGRVYTSDFEPITNPKFDDTFEKNLSSV
RQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgcggcacatctaccaatgcaaatatgatggcggcatataatgggggcaca
tcaacagcagctgggggtcaccaccaccatcatcatcaccatcacctggcccatttgccc
cctccccacctacaccatcatcaccacctccatccacagcatcatctgcacccaggctca
gcagcagctgtacaccctgttcagcagcatgtctcctcttcatcagcttcctcttcagct
gccgccgctgctgctgcagcggctgcagcagcagcaatgctaaatccaggacaggcccag
tcgtactttccatctccagctccagggcaagctccaggtcctgcagcagcagtggccccg
gctcaagtgcaggctgctgcagtaaaggctcaccatcatcagcactctcatcatgcccag
caactggatattgaacctgatcgtcccattggttatggtgcatttggagttgtctggtca
gtaacagatccaagagatggaaaaagagttgctctgaaaaagatgcccaacgtcttccag
aatctagtctcttgcaagagggtcttccgagaattgaagatgttgtgtttttttaagcat
gacaacgtactctcagcacttgatattctccagccacctcatattgattattttgaagaa
atatatgttgtcacggaattaatgcagagtgaccttcataagatcattgtctctcctcag
cctctcagttcagatcatgtcaaggtttttttgtatcagattttaagaggtctgaagtat
ttgcattcagctggcattttacatcgagatattaaaccagggaatctacttgtgaacagc
aactgcgttcttaagatctgtgattttggattggcaagggttgaagaactcgatgaatct
cggcatatgactcaggaagttgtcactcagtattatcgggctccagaaatcctcatgggg
agtcgacattataccaacgctatagacatctggtctgtagggtgcatttttgcagagtta
ctcgggcgaagaatattgtttcaagctcaaagtccaatccaacagttggacttaatcact
gatttgttgggtacaccgtcactagaagcaatgagaacggcttgtgaaggagccaaggca
cacatactcaggggtcctcataaacagccatctcttcctgtcctctacacactgtccagc
caggcaactcatgaagctgtccatctgctctgcaggatgctggtctttgatccatccaaa
cggatatcggctaaagatgccttggctcacccgtacctggatgaaggccgcttgcgatat
cacacttgcatgtgcaaatgttgtttttcaacttcttccgggagggtctacaccagtgat
tttgagccgatcacaaatccaaaatttgatgacacttttgaaaagaacctcagttctgtt
cggcaggtgaaagaaataattcatcagtttatattggaacagcagaaaggaaacagagta
cctctgtgcatcaatcctcagtctgctgcttttaaaagctttataagttccactgttgct
caaccctccgagatgccaccatctccactggtttgggagtga

DBGET integrated database retrieval system