KEGG   Xenopus laevis (African clawed frog): 414600Help
Entry
414600            CDS       T01010                                 

Gene name
usp44-a, usp44
Definition
ubiquitin specific peptidase 44 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 690 aa AA seqDB search
MDKCKHVGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALRHFQD
SKHPLALEVNELYVFCYLCDDYVLNDNTTGDLKLLRSTLSAIKSQNYDCTTRSGRTLRSM
VTADDSFISHEGAQAFLQNEDRAFTALWHRRHALLGKVFRSWFALTPKGKQRLEEERLRE
EAEQKREEARKKRQQLKRKLKEEMESTSPRKSSRLQHQIQPSPKTELPSVQKMNQKNSPT
TKQKTPAPTSDKACFKKIGNSPIKRKPTVTPGVTGLRNLGNTCYMNSILQILSHLHVFRE
CFLQLDLNQTQELLAAAGSGKTRLSSKYPPGAELPRVTQKHTKVQRSLARRQSFSLGLSG
GASNSRNMELIQPKEPSSKHISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRG
YAQQDAQEFLCELLDKVQQELETTGTRYPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVT
CLVCDHKSNTIEPFWDLSLEFPERYHFNGKETASQRPCLLTEMLAKFTETEALEGKIYAC
DQCNKAQKQLMVCRLPQVLRLHLKRFRWSGRNHREKIGVHVRFDQMLNMEPYCCRESTAA
LRADCFIYDLSSVVMHHGKGFGSGHYTAFCYNPEGGFWVHCNDSKLHSCTVEEVCKAQAY
ILFYTQRVTQENGHLSDTLPVHGSPQSPPR
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggataaatgtaaacatgttggccgcttgcgtcttgcccaagatcattcaattttgaac
cctcagaagtggcactgtgtggattgcaacactacagaatcagtgtgggcttgcctaagc
tgttcacatgttgcgtgtggtcgatacattgaagagcatgcactgcgtcactttcaggac
agtaagcatcctttggctttggaggttaatgaactttatgttttttgttacctctgtgat
gattatgttctcaatgacaacaccactggtgaccttaaacttttacgaagcacattaagt
gccatcaaaagtcagaattatgactgtacaacacgtagtggtcggactttgcgttctatg
gtaactgcagatgattcattcatttcacatgaaggtgcacaagcctttcttcagaatgaa
gaccgtgcattcactgcattgtggcatcggaggcatgctctcttggggaaggtttttagg
tcgtggtttgcgttgactccaaaaggcaagcaaaggttagaagaggaacgcttgagggaa
gaggcagagcagaagagggaggaagcgagaaaaaagcggcagcagttgaagcgcaaatta
aaggaagaaatggaaagcacttcccctagaaaaagttcacgtttgcaacatcaaatacag
ccttcacccaaaactgaattgccctctgtgcaaaaaatgaaccaaaaaaactctcctacc
acaaaacaaaaaacaccagcacctacctctgataaagcatgcttcaagaaaatcggtaat
tctccaataaaaaggaagcccactgtgacccccggagtaacaggactgaggaatctgggg
aacacctgctatatgaactcaatacttcagatactgagtcatttgcacgttttccgggag
tgttttttacaacttgatctcaatcaaactcaggagttgttggcagctgctggcagtgga
aaaacaaggttgtccagcaaatacccacctggtgctgagctaccaagagtaacacaaaag
cacactaaagttcaaagatcactggcaaggcgtcagagcttctccttgggacttagtggt
ggggcttcaaatagtagaaacatggaacttattcagcctaaggagccaagttcaaagcac
atatctctatgccatgaattgcataccctcttccaagtcatgtggtcaggtaaatgggca
ctggtttctccttttgcaatgctacattcagtgtggaggcttataccagccttccgcggg
tatgcacagcaagatgctcaggaattcctctgtgaactattagataaagtacaacaagaa
ttggagacaactggcactagatacccagccctaattcctacttctcaaagaaaactcatc
aaacaggtcctgaatgtcgtcaacaacatttttcatgggcaactacttagtcaggttact
tgtctcgtctgtgatcacaagtcaaataccatcgagccattttgggacctgtcccttgag
tttcccgagaggtatcacttcaatggcaaagagactgcttcccaacggccttgtctgctg
acagaaatgctggccaaattcacagagactgaagccttagaagggaagatctacgcttgt
gatcagtgcaacaaagcacagaagcagctgatggtgtgtcgcttacctcaggtcctgaga
ctccacctcaagagattcaggtggtctggccgcaatcatcgagaaaaaatcggagtgcat
gttcgatttgaccagatgctgaacatggagccttactgttgtagagagtccactgcagcc
ctgagagccgactgcttcatttatgatctgtcctctgtggtgatgcatcatgggaaaggc
tttggttctggccattacactgccttttgttacaatccggaaggaggtttctgggtacac
tgcaatgactccaagctgcattcatgtaccgtggaagaggtgtgcaaggcacaagcatac
atcttattttacacccagcgagttactcaggagaatggacatttgtcagacactcttcct
gtccatggcagtccgcaatccccaccccgttga

DBGET integrated database retrieval system