KEGG   Xenopus laevis (African clawed frog): 414627Help
Entry
414627            CDS       T01010                                 

Definition
uncharacterized protein MGC81376
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     414627
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M67
   414627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 431 aa AA seqDB search
MEQPISVSSLKKLVAVPDHTDVSLSPDERVRVLSKLGCNITINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPGHRDYQQYEIPEKQDILTKLKEVAFPRTDV
LKKDLLKKYNLEYQEYLQGIHKRKSECLKKLEQQQLIDAEKKRLAQLRQQQIETEQFSFF
EDQLRKQDLIRDQLKNKDAPKVPEQIDGGMVTCISTTKSSSKEQAKRNDASIYTGQSPPV
TRALKPAATLSAVQNEIVDGLRLVALPRDLSHRFLQLAEANTSRGIETCGILCGKLTHDE
FTITHVIVPKQSAGPDYCDMENVEELFNVQDQHNLLTLGWIHTHPTQTAFLSSVDLHTHC
SYQLMLPEAIAIVCSPKHNDTGIFRLTSAGMLEVSACKKKGFHPHSKEPRQFNTCRHVMV
RDAGITVLDLR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgatctctgtttcttctctgaagaagctggtggctgttccagatcacacc
gacgtatcactaagcccagatgagcgcgtgcgagtgctaagcaagttgggctgtaacatc
accatcaatgaagacatcacgccaaggcgatatttccgctcgggggtggagatggagagg
atggcgtcggtgtatttggaagaaggaaaccttgaaaatgcctttgttctctacaacaaa
tttatcacgttatttgtagaaaaactgcccggacacagagactatcagcaatatgaaatt
cccgaaaagcaagatatattgacgaaactcaaggaagttgcatttccaagaacggacgta
ctaaagaaggatctgctgaagaaatacaacctggaataccaggagtacctacaaggcata
cacaagcggaaatcggaatgcctgaagaaactggagcaacagcagttaatagatgcggaa
aaaaagcgcctggcgcaattacgccaacaacagatcgaaacggaacagttcagcttcttc
gaggaccagctgcggaagcaggacttgatcagagatcagctgaaaaataaagatgcgcca
aaggtgccggagcagattgatggcggaatggtgacctgcatctctaccaccaaatccagc
tctaaagaacaggcaaagaggaatgatgcctctatctataccgggcagtcccctcctgtg
accagagccttgaaaccagcagctacactgagtgctgtgcagaatgaaatagtggatggc
cttcggctggttgcactgcccagggatctgtcccaccgatttctacagttggctgaagcc
aatacttccagagggatcgagacctgtggtatcctctgtggcaaactgactcacgatgaa
ttcaccatcacccatgtgattgtaccaaagcagtctgcgggaccggactactgtgacatg
gagaatgtggaggaactatttaatgtacaggatcagcacaacctcctcaccctgggttgg
atccatacgcatccaactcagacagcgttcctatccagcgtggatcttcatactcactgc
tcctatcagctcatgttaccagaagccattgccattgtttgttcaccaaagcacaatgat
actggaatcttccgactcactagcgccgggatgttggaggtgtctgcatgtaaaaagaag
ggcttccaccctcacagcaaagagcccagacaattcaatacctgcagacacgtgatggta
cgagatgccggtatcactgttctggacctgaggtga

DBGET integrated database retrieval system