KEGG   Xenopus laevis (African clawed frog): 414686Help
Entry
414686            CDS       T01010                                 

Gene name
chp1.S, chp
Definition
(RefSeq) calcineurin-like EF-hand protein 1 S homeolog
  KO
K17610  
calcineurin B homologous protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     414686 (chp1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 166 aa AA seqDB search
MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLREDQVNFRGFMRTL
AHFRPVEDNSKDAKSQEPLNSRSNKLLFAFRLYDLDKDDKISRDELLQVLRMMVGVNISD
EQLGSIADRTIQEADQDGDSSISFTEFVKVLEKVDVEQKMSIRFLH
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgggctccagagcgtcaacgctgctcagggatgaggagatagaagagattaagaaggag
acgggcttttctcacagccagataactcgactgtacagtcgcttcacaagtctggataaa
ggagagaacgggactctgagagaggaccaggtgaatttccgaggcttcatgaggactttg
gcacacttccgccctgttgaagataattcgaaagatgcaaagagccaagagccactgaac
agcagaagcaataaattgttatttgcattccgtctctatgacttggacaaagatgacaag
atctccagggatgagctgttacaggtcctacgcatgatggtgggtgtgaacatatctgac
gagcaactgggtagcattgctgaccgtactattcaggaagctgaccaagatggagacagt
tccatatcattcactgagtttgttaaggttttagaaaaggttgatgtcgaacagaaaatg
agcatccgtttcctacactga

DBGET integrated database retrieval system