KEGG   Xenopus laevis (African clawed frog): 414694Help
Entry
414694            CDS       T01010                                 

Gene name
map2k5
Definition
mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    414694 (map2k5)
 Cellular Processes
  Cell communication
   04540 Gap junction
    414694 (map2k5)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     414694 (map2k5)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   414694 (map2k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 448 aa AA seqDB search
MLLFGFGLPQDMDCQALVIRIRIPDGGAVDWTVQPATQLLFRDILDVIGQVIPDATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYCSMVLEQQGSGPLMEPLQIYPRACKPPGKRNIHGL
KVNTRAGSSSSSSPSVPDNISSNCLKKSSAELKKILANGQINELDIQCRDILGHGNGGTV
YKAYHVPSGKILAVKVIPLDITVELQRQIMSELEILYKCDSLYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEQVLGRIAVAVLKGLTYLWSLKILHRDVKPSNMLVNTRGHVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERIAGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNHGSLMPLQILQCIVDEECPVLPVGEFSESFVHFITQCMRKPPKERPAPEMLMDHPFIV
QFNDGNTEAVSMWVCRALEERRLQSGQA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgttatttggcttcggcctgcctcaggacatggattgccaggctctggtcattcgg
atacgaatccctgatggaggcgccgtagactggacagtacagccggccactcagttgctg
ttccgggacatcctggatgtgattggtcaagttatccctgatgcaacaaccactgccttt
gagtacgaagatgaggatggtgatcggattacagttcggagtgatgaggaaatgaaggcc
atgttgtcatattattgcagcatggtccttgagcaacagggaagtggacctctgatggaa
cctctgcagatctatccacgtgcctgcaagcctcccgggaagcggaacatacatggcctc
aaggtgaacacccgagccggatcttccagtagcagcagtccatctgtgccagacaatatt
tccagcaattgtttaaagaagtcctctgctgaattaaagaagattttagccaatggacag
attaatgagcttgatatccagtgccgtgacattctggggcatggaaatggagggaccgtg
tataaagcgtatcatgtgccaagtggaaagattctggctgtaaaggtcatcccattagat
attactgtggagctgcagagacagataatgtcagagcttgaaatcctgtacaagtgcgat
tctctgtacataattgggttttatggagcgttttttgtggaaaaccggatttccatctgt
actgaatttatggatggtggatccctggatgtgtacagaaagattccagagcaggttctt
ggtagaatcgctgttgctgtattgaaaggcttgacttacctgtggagcttaaagatttta
cacagagatgtgaaaccttccaacatgctagtgaacacacgtggccatgtgaagttgtgt
gactttggtgtgagcactcagttggtgaattctattgccaagacgtatgtgggaacaaat
gcttatatggcgccagagcgtattgcaggagaacaatatggaatccactctgatgtctgg
agtttgggcatctctttcatggagttggctcttggaagattcccttatccacagattcag
aaaaaccacggatctttaatgccgctccagatattgcaatgcattgttgatgaggagtgt
cctgtcctccccgtgggtgaattctctgaatcctttgtgcacttcattacacaatgtatg
agaaagccaccgaaggagagaccagctcccgaaatgctgatggatcatcctttcattgtc
cagttcaatgatgggaacacagaagccgtgtccatgtgggtgtgtcgggcgctggaagag
aggaggttacaaagtggacaggcgtaa

DBGET integrated database retrieval system