KEGG   Xenopus laevis (African clawed frog): 414724Help
Entry
414724            CDS       T01010                                 

Gene name
mad2l1.L, XMad2, mad2
Definition
(RefSeq) MAD2 mitotic arrest deficient-like 1 L homeolog
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    414724 (mad2l1.L)
   04114 Oocyte meiosis
    414724 (mad2l1.L)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    414724 (mad2l1.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     414724 (mad2l1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA ATG101
Motif
Other DBs
NCBI-GeneID: 414724
NCBI-ProteinID: NP_001084751
Xenbase: XB-GENE-17331003
UniProt: Q6NU84
Position
1L
AA seq 203 aa AA seqDB search
MAGQLTREGITLKGSAEIVSEFFYCGINSILYQRGIYPSETFTRVQKYGLTLLVSTDPAL
KEYLNKVTDQLKEWLYKCQVQKLVVVITSIDSSEILERWQFDIECDKTVKDGIVREKSQK
VIQEEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVR
LRSFTTTIHKVNSMVAYKKIDTF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcagttaacacgtgaagggattaccctgaagggcagcgctgaaatcgtatca
gagtttttctattgtggcatcaatagcattttatatcagcgtgggatttatccatcagaa
acattcacgcgtgttcagaagtatgggctcacgctgctagtctctacagacccagcactg
aaagagtatttaaacaaagttacagatcagctgaaagaatggttgtacaaatgccaagta
cagaagcttgtggttgtgatcacaagtattgacagcagcgaaattcttgaacgttggcaa
tttgacatagagtgtgacaaaactgtgaaagatggcattgttcgcgaaaagtcacagaag
gttattcaagaagaaattcgatcggttataaggcagataactgctactgtaactttcctt
cctttgctggaaacagcatgtgcctttgacctgctgatatatacagataaagatttggag
gtacctgagaaatgggaggaatctggtcctcagtttgtgtccaactctgaagaggtccgt
ctgcgttcattcacaacaaccatccacaaagtaaatagtatggtggcgtacaaaaagata
gacactttctaa

DBGET integrated database retrieval system