KEGG   Xenopus laevis (African clawed frog): 414724Help
Entry
414724            CDS       T01010                                 

Definition
uncharacterized protein MGC81153
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    414724
   04114 Oocyte meiosis
    414724
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    414724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 203 aa AA seqDB search
MAGQLTREGITLKGSAEIVSEFFYCGINSILYQRGIYPSETFTRVQKYGLTLLVSTDPAL
KEYLNKVTDQLKEWLYKCQVQKLVVVITSIDSSEILERWQFDIECDKTVKDGIVREKSQK
VIQEEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVR
LRSFTTTIHKVNSMVAYKKIDTF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcagttaacacgtgaagggattaccctgaagggcagcgctgaaatcgtatca
gagtttttctattgtggcatcaatagcattttatatcagcgtgggatttatccatcagaa
acattcacgcgtgttcagaagtatgggctcacgctgctagtctctacagacccagcactg
aaagagtatttaaacaaagttacagatcagctgaaagaatggttgtacaaatgccaagta
cagaagcttgtggttgtgatcacaagtattgacagcagcgaaattcttgaacgttggcaa
tttgacatagagtgtgacaaaactgtgaaagatggcattgttcgcgaaaagtcacagaag
gttattcaagaagaaattcgatcggttataaggcagataactgctactgtaactttcctt
cctttgctggaaacagcatgtgcctttgacctgctgatatatacagataaagatttggag
gtacctgagaaatgggaggaatctggtcctcagtttgtgtccaactctgaagaggtccgt
ctgcgttcattcacaacaaccatccacaaagtaaatagtatggtggcgtacaaaaagata
gacactttctaa

DBGET integrated database retrieval system