KEGG   Xenopus laevis (African clawed frog): 414724Help
Entry
414724            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC81153
  KO
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    414724
   04114 Oocyte meiosis
    414724
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    414724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 203 aa AA seqDB search
MAGQLTREGITLKGSAEIVSEFFYCGINSILYQRGIYPSETFTRVQKYGLTLLVSTDPAL
KEYLNKVTDQLKEWLYKCQVQKLVVVITSIDSSEILERWQFDIECDKTVKDGIVREKSQK
VIQEEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVR
LRSFTTTIHKVNSMVAYKKIDTF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcagttaacacgtgaagggattaccctgaagggcagcgctgaaatcgtatca
gagtttttctattgtggcatcaatagcattttatatcagcgtgggatttatccatcagaa
acattcacgcgtgttcagaagtatgggctcacgctgctagtctctacagacccagcactg
aaagagtatttaaacaaagttacagatcagctgaaagaatggttgtacaaatgccaagta
cagaagcttgtggttgtgatcacaagtattgacagcagcgaaattcttgaacgttggcaa
tttgacatagagtgtgacaaaactgtgaaagatggcattgttcgcgaaaagtcacagaag
gttattcaagaagaaattcgatcggttataaggcagataactgctactgtaactttcctt
cctttgctggaaacagcatgtgcctttgacctgctgatatatacagataaagatttggag
gtacctgagaaatgggaggaatctggtcctcagtttgtgtccaactctgaagaggtccgt
ctgcgttcattcacaacaaccatccacaaagtaaatagtatggtggcgtacaaaaagata
gacactttctaa

DBGET integrated database retrieval system